Cmc12g0332421 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GAGTTTGAGAGACAGTTACTCAAAACGTCAGGCGCTTAGATGCATTCATATTGCTTATTATGTGTTCAGCATGACCCACTTTGTAGACCTTCCATGGCATCCATTGTTCTTATGCTTAACCGTCATTCCACTACTTTGCCCTTGCCTAAAAAGCCAGCATTCTTTACGTGCAGTAAAGATGGTGGCATTGTGATAGAAAGTGATCGATCTACACGAATCTCTGATCATTCGTCTGCTAATGAAATATGTATGTCTGAATTGTGCACACGATAGAGAATGTCTCACTTGCATTCTAAATATTTTGTATTTGTTTGTT GAGTTTGAGAGACAGTTACTCAAAACGTCAGGCGCTTAGATGCATTCATATTGCTTATTATGTGTTCAGCATGACCCACTTTGTAGACCTTCCATGGCATCCATTGTTCTTATGCTTAACCGTCATTCCACTACTTTGCCCTTGCCTAAAAAGCCAGCATTCTTTACGTGCAGTAAAGATGGTGGCATTGTGATAGAAAGTGATCGATCTACACGAATCTCTGATCATTCGTCTGCTAATGAAATATGTATGTCTGAATTGTGCACACGATAGAGAATGTCTCACTTGCATTCTAAATATTTTGTATTTGTTTGTT ATGCATTCATATTGCTTATTATGTGTTCAGCATGACCCACTTTGTAGACCTTCCATGGCATCCATTGTTCTTATGCTTAACCGTCATTCCACTACTTTGCCCTTGCCTAAAAAGCCAGCATTCTTTACGTGCAGTAAAGATGGTGGCATTGTGATAGAAAGTGATCGATCTACACGAATCTCTGATCATTCGTCTGCTAATGAAATATGTATGTCTGAATTGTGCACACGATAG MHSYCLLCVQHDPLCRPSMASIVLMLNRHSTTLPLPKKPAFFTCSKDGGIVIESDRSTRISDHSSANEICMSELCTR Homology
BLAST of Cmc12g0332421 vs. NCBI nr
Match: XP_011652851.1 (putative receptor-like protein kinase At4g00960 [Cucumis sativus] >KGN64566.2 hypothetical protein Csa_013649 [Cucumis sativus]) HSP 1 Score: 121.3 bits (303), Expect = 3.6e-24 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of Cmc12g0332421 vs. NCBI nr
Match: XP_022139941.1 (cysteine-rich receptor-like protein kinase 10 [Momordica charantia]) HSP 1 Score: 82.8 bits (203), Expect = 1.4e-12 Identity = 45/72 (62.50%), Postives = 53/72 (73.61%), Query Frame = 0
BLAST of Cmc12g0332421 vs. NCBI nr
Match: XP_008446411.2 (PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis melo]) HSP 1 Score: 80.9 bits (198), Expect = 5.4e-12 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cmc12g0332421 vs. NCBI nr
Match: KAA0056887.1 (cysteine-rich receptor-like protein kinase 10 [Cucumis melo var. makuwa]) HSP 1 Score: 80.9 bits (198), Expect = 5.4e-12 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cmc12g0332421 vs. NCBI nr
Match: TYJ99390.1 (cysteine-rich receptor-like protein kinase 10 [Cucumis melo var. makuwa]) HSP 1 Score: 80.9 bits (198), Expect = 5.4e-12 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy Swiss-Prot
Match: O23082 (Putative receptor-like protein kinase At4g00960 OS=Arabidopsis thaliana OX=3702 GN=At4g00960 PE=3 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 4.2e-07 Identity = 35/75 (46.67%), Postives = 47/75 (62.67%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy Swiss-Prot
Match: Q8L7G3 (Cysteine-rich receptor-like protein kinase 7 OS=Arabidopsis thaliana OX=3702 GN=CRK7 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.1e-07 Identity = 25/53 (47.17%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy Swiss-Prot
Match: Q8GYA4 (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana OX=3702 GN=CRK10 PE=1 SV=3) HSP 1 Score: 51.6 bits (122), Expect = 4.6e-06 Identity = 23/54 (42.59%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy Swiss-Prot
Match: O65405 (Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana OX=3702 GN=CRK28 PE=3 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 6.0e-06 Identity = 30/72 (41.67%), Postives = 40/72 (55.56%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy Swiss-Prot
Match: Q9ZP16 (Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CRK11 PE=2 SV=2) HSP 1 Score: 50.8 bits (120), Expect = 7.8e-06 Identity = 25/61 (40.98%), Postives = 39/61 (63.93%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy TrEMBL
Match: A0A0A0LS37 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G064800 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 1.7e-24 Identity = 61/72 (84.72%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy TrEMBL
Match: A0A6J1CE69 (cysteine-rich receptor-like protein kinase 10 OS=Momordica charantia OX=3673 GN=LOC111010730 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 6.9e-13 Identity = 45/72 (62.50%), Postives = 53/72 (73.61%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy TrEMBL
Match: A0A5A7UQH5 (Cysteine-rich receptor-like protein kinase 10 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold96G00560 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.6e-12 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy TrEMBL
Match: A0A5D3BHV8 (Cysteine-rich receptor-like protein kinase 10 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold248G006080 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.6e-12 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cmc12g0332421 vs. ExPASy TrEMBL
Match: A0A1S3BF04 (cysteine-rich receptor-like protein kinase 10 OS=Cucumis melo OX=3656 GN=LOC103489161 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.6e-12 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cmc12g0332421 vs. TAIR 10
Match: AT4G00960.1 (Protein kinase superfamily protein ) HSP 1 Score: 55.1 bits (131), Expect = 2.9e-08 Identity = 35/75 (46.67%), Postives = 47/75 (62.67%), Query Frame = 0
BLAST of Cmc12g0332421 vs. TAIR 10
Match: AT4G23150.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 7 ) HSP 1 Score: 54.3 bits (129), Expect = 5.0e-08 Identity = 25/53 (47.17%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Cmc12g0332421 vs. TAIR 10
Match: AT4G23180.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 10 ) HSP 1 Score: 51.6 bits (122), Expect = 3.3e-07 Identity = 23/54 (42.59%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Cmc12g0332421 vs. TAIR 10
Match: AT4G21400.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 28 ) HSP 1 Score: 51.2 bits (121), Expect = 4.3e-07 Identity = 30/72 (41.67%), Postives = 40/72 (55.56%), Query Frame = 0
BLAST of Cmc12g0332421 vs. TAIR 10
Match: AT4G23190.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 11 ) HSP 1 Score: 50.8 bits (120), Expect = 5.6e-07 Identity = 25/61 (40.98%), Postives = 39/61 (63.93%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|