Cmc11g0303471 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAGAAGGTGTAAAATCAGTGGGTGTCGGAGCTACTATAATCGTTTCAGCGGGAGCTGCTGTCAGTATTGGAAACGTCTTTAGTTCATTGATCCATTCCGTGGTGCGAAATCCATCATTGGCTAAAAAATCATTTGGTTATGCAATTTTGGGCTTTGCTCTAATTGAAGCTATTGCATTGTTTGCTCTAATGATGGCCTTTTTGATCTAA ATGTTAGAAGGTGTAAAATCAGTGGGTGTCGGAGCTACTATAATCGTTTCAGCGGGAGCTGCTGTCAGTATTGGAAACGTCTTTAGTTCATTGATCCATTCCGTGGTGCGAAATCCATCATTGGCTAAAAAATCATTTGGTTATGCAATTTTGGGCTTTGCTCTAATTGAAGCTATTGCATTGTTTGCTCTAATGATGGCCTTTTTGATCTAA ATGTTAGAAGGTGTAAAATCAGTGGGTGTCGGAGCTACTATAATCGTTTCAGCGGGAGCTGCTGTCAGTATTGGAAACGTCTTTAGTTCATTGATCCATTCCGTGGTGCGAAATCCATCATTGGCTAAAAAATCATTTGGTTATGCAATTTTGGGCTTTGCTCTAATTGAAGCTATTGCATTGTTTGCTCTAATGATGGCCTTTTTGATCTAA MLEGVKSVGVGATIIVSAGAAVSIGNVFSSLIHSVVRNPSLAKKSFGYAILGFALIEAIALFALMMAFLI Homology
BLAST of Cmc11g0303471 vs. NCBI nr
Match: BBD20408.1 (ATP synthase subunit 9 [Allium cepa]) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. NCBI nr
Match: BBD20369.1 (ATP synthase subunit 9 [Allium cepa]) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. NCBI nr
Match: YP_009252189.1 (Atp9 [Allium cepa] >ANA91173.1 Atp9 [Allium cepa] >AYQ93871.1 ATP synthase subunit 9 [Allium cepa]) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. NCBI nr
Match: BAA02855.2 (F0-ATPase subunit 9 [Brassica napus]) HSP 1 Score: 104.8 bits (260), Expect = 3.2e-19 Identity = 59/70 (84.29%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. NCBI nr
Match: YP_004849343.1 (ATPase subunit 9 [Cucumis sativus] >ADZ10770.1 ATPase subunit 9 [Cucumis sativus]) HSP 1 Score: 104.4 bits (259), Expect = 4.1e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy Swiss-Prot
Match: P69420 (ATP synthase subunit 9, mitochondrial OS=Pisum sativum OX=3888 GN=ATP9 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-21 Identity = 59/70 (84.29%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy Swiss-Prot
Match: P69421 (ATP synthase subunit 9, mitochondrial OS=Glycine max OX=3847 GN=ATP9 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-21 Identity = 59/70 (84.29%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy Swiss-Prot
Match: P69422 (ATP synthase subunit 9, mitochondrial OS=Vicia faba OX=3906 GN=ATP9 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-21 Identity = 59/70 (84.29%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy Swiss-Prot
Match: P60113 (ATP synthase subunit 9, mitochondrial OS=Brassica napus OX=3708 GN=ATP9 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 2.7e-21 Identity = 58/70 (82.86%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy Swiss-Prot
Match: P14571 (ATP synthase subunit 9, mitochondrial OS=Beta vulgaris OX=161934 GN=ATP9 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.0e-20 Identity = 57/70 (81.43%), Postives = 60/70 (85.71%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy TrEMBL
Match: A0A160DQR7 (ATP synthase subunit 9, mitochondrial OS=Allium cepa OX=4679 GN=atp9 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.2e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy TrEMBL
Match: A0A3Q9WJW7 (ATP synthase subunit 9, mitochondrial OS=Allium cepa OX=4679 GN=atp9 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.2e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy TrEMBL
Match: A0A387J002 (ATP synthase subunit 9, mitochondrial OS=Allium cepa OX=4679 GN=atp9 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.2e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy TrEMBL
Match: A0A5A7U949 (ATPase subunit 9 (Mitochondrion) OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold75926G00010 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 2.0e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. ExPASy TrEMBL
Match: G3EU40 (ATP synthase subunit 9, mitochondrial OS=Cucumis melo subsp. melo OX=412675 GN=atp9 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 2.0e-19 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc11g0303471 vs. TAIR 10
Match: AT2G07671.1 (ATP synthase subunit C family protein ) HSP 1 Score: 102.1 bits (253), Expect = 1.9e-22 Identity = 58/70 (82.86%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of Cmc11g0303471 vs. TAIR 10
Match: ATMG01080.1 (mitochondrial F0-ATPase subunit 9 ) HSP 1 Score: 102.1 bits (253), Expect = 1.9e-22 Identity = 58/70 (82.86%), Postives = 61/70 (87.14%), Query Frame = 0
BLAST of Cmc11g0303471 vs. TAIR 10
Match: ATMG00040.1 (ATP synthase subunit C family protein ) HSP 1 Score: 61.6 bits (148), Expect = 2.9e-10 Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|