
Cmc11g0303461 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGCTCACTCTCAGTTTGGTCCTACTTCTGCTTCATTTTTCTACTAAAAACGAAGGAGGAAACTCAGTACTAAATGCTTGGCAATCCTTGGTAGAGCTTATTTATGATTTCGTCCTAAACCTAATAAATGAACAAATAGGTGGTCTTTTCGGAAATGTGAAACAAAAGTTTTTCCCTCATTCTTATTTCAGTTTTTTATTACCTGCAGGAGTCCCACTGCCATTAGCACTTTTTTTAGTACTCCTTGAGCTAATCCCTCATTGTTTTCGCGCATTAAGCTCATGA ATGATGCTCACTCTCAGTTTGGTCCTACTTCTGCTTCATTTTTCTACTAAAAACGAAGGAGGAAACTCAGTACTAAATGCTTGGCAATCCTTGGTAGAGCTTATTTATGATTTCGTCCTAAACCTAATAAATGAACAAATAGGTGGTCTTTTCGGAAATGTGAAACAAAAGTTTTTCCCTCATTCTTATTTCAGTTTTTTATTACCTGCAGGAGTCCCACTGCCATTAGCACTTTTTTTAGTACTCCTTGAGCTAATCCCTCATTGTTTTCGCGCATTAAGCTCATGA ATGATGCTCACTCTCAGTTTGGTCCTACTTCTGCTTCATTTTTCTACTAAAAACGAAGGAGGAAACTCAGTACTAAATGCTTGGCAATCCTTGGTAGAGCTTATTTATGATTTCGTCCTAAACCTAATAAATGAACAAATAGGTGGTCTTTTCGGAAATGTGAAACAAAAGTTTTTCCCTCATTCTTATTTCAGTTTTTTATTACCTGCAGGAGTCCCACTGCCATTAGCACTTTTTTTAGTACTCCTTGAGCTAATCCCTCATTGTTTTCGCGCATTAAGCTCATGA MMLTLSLVLLLLHFSTKNEGGNSVLNAWQSLVELIYDFVLNLINEQIGGLFGNVKQKFFPHSYFSFLLPAGVPLPLALFLVLLELIPHCFRALSS Homology
BLAST of Cmc11g0303461 vs. NCBI nr
Match: AEN56130.1 (ATPase subunit 6 [Cucumis melo subsp. melo] >AZP40292.1 ATPase subunit 6 [Cucumis melo var. momordica]) HSP 1 Score: 139.0 bits (349), Expect = 2.1e-29 Identity = 84/146 (57.53%), Postives = 87/146 (59.59%), Query Frame = 0
BLAST of Cmc11g0303461 vs. NCBI nr
Match: YP_004849344.1 (ATPase subunit 6 [Cucumis sativus] >ADZ10771.1 ATPase subunit 6 [Cucumis sativus]) HSP 1 Score: 139.0 bits (349), Expect = 2.1e-29 Identity = 84/146 (57.53%), Postives = 87/146 (59.59%), Query Frame = 0
BLAST of Cmc11g0303461 vs. NCBI nr
Match: YP_010144785.1 (ATPase subunit 6 [Mirabilis jalapa] >QQL93501.1 ATPase subunit 6 [Mirabilis jalapa]) HSP 1 Score: 136.7 bits (343), Expect = 1.0e-28 Identity = 83/146 (56.85%), Postives = 86/146 (58.90%), Query Frame = 0
BLAST of Cmc11g0303461 vs. NCBI nr
Match: YP_010127591.1 (ATP synthase subunit 6 [Bougainvillea spectabilis] >QPP04915.1 ATP synthase subunit 6 [Bougainvillea spectabilis]) HSP 1 Score: 136.7 bits (343), Expect = 1.0e-28 Identity = 83/146 (56.85%), Postives = 86/146 (58.90%), Query Frame = 0
BLAST of Cmc11g0303461 vs. NCBI nr
Match: YP_009861450.1 (ATPase subunit 6 [Mirabilis himalaica] >QKN19347.1 ATPase subunit 6 [Mirabilis himalaica]) HSP 1 Score: 135.2 bits (339), Expect = 3.0e-28 Identity = 82/146 (56.16%), Postives = 85/146 (58.22%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy Swiss-Prot
Match: P05499 (ATP synthase subunit a OS=Nicotiana tabacum OX=4097 GN=ATP6 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.1e-28 Identity = 78/146 (53.42%), Postives = 84/146 (57.53%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy Swiss-Prot
Match: P05500 (ATP synthase subunit a OS=Oenothera berteroana OX=3950 GN=ATP6 PE=2 SV=2) HSP 1 Score: 122.9 bits (307), Expect = 2.0e-27 Identity = 77/145 (53.10%), Postives = 83/145 (57.24%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy Swiss-Prot
Match: Q04654 (ATP synthase subunit a OS=Vicia faba OX=3906 GN=ATP6 PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 5.8e-27 Identity = 76/145 (52.41%), Postives = 82/145 (56.55%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy Swiss-Prot
Match: P93298 (ATP synthase subunit a-1 OS=Arabidopsis thaliana OX=3702 GN=ATP6-1 PE=2 SV=2) HSP 1 Score: 119.8 bits (299), Expect = 1.7e-26 Identity = 75/145 (51.72%), Postives = 81/145 (55.86%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy Swiss-Prot
Match: P92547 (ATP synthase subunit a-2 OS=Arabidopsis thaliana OX=3702 GN=ATP6-2 PE=2 SV=2) HSP 1 Score: 119.8 bits (299), Expect = 1.7e-26 Identity = 75/145 (51.72%), Postives = 81/145 (55.86%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy TrEMBL
Match: G3EU41 (ATP synthase subunit a OS=Cucumis melo subsp. melo OX=412675 GN=atp6 PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 1.0e-29 Identity = 84/146 (57.53%), Postives = 87/146 (59.59%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy TrEMBL
Match: G3EIZ6 (ATP synthase subunit a OS=Cucumis sativus OX=3659 GN=atp6 PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 1.0e-29 Identity = 84/146 (57.53%), Postives = 87/146 (59.59%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy TrEMBL
Match: A0A3S5HPI7 (ATP synthase subunit a OS=Cucumis melo var. momordica OX=2034244 GN=atp6 PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 1.0e-29 Identity = 84/146 (57.53%), Postives = 87/146 (59.59%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy TrEMBL
Match: A0A7T7FPD7 (ATPase subunit 6 OS=Mirabilis jalapa OX=3538 GN=atp6 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 4.9e-29 Identity = 83/146 (56.85%), Postives = 86/146 (58.90%), Query Frame = 0
BLAST of Cmc11g0303461 vs. ExPASy TrEMBL
Match: A0A7T1WRP8 (ATP synthase subunit 6 OS=Bougainvillea spectabilis OX=146096 GN=atp6 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 4.9e-29 Identity = 83/146 (56.85%), Postives = 86/146 (58.90%), Query Frame = 0
BLAST of Cmc11g0303461 vs. TAIR 10
Match: AT2G07741.1 (ATPase, F0 complex, subunit A protein ) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-27 Identity = 75/145 (51.72%), Postives = 81/145 (55.86%), Query Frame = 0
BLAST of Cmc11g0303461 vs. TAIR 10
Match: ATMG01170.1 (ATPase, F0 complex, subunit A protein ) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-27 Identity = 75/145 (51.72%), Postives = 81/145 (55.86%), Query Frame = 0
BLAST of Cmc11g0303461 vs. TAIR 10
Match: ATMG00410.1 (ATPase subunit 6-1 ) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-27 Identity = 75/145 (51.72%), Postives = 81/145 (55.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|