
Cmc11g0303371 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCACAACCAAGTTTATCAAATGTGTCATGCTCGGCGACGGCGCCGTCATAAAGACTTGTATGCTCATTTCTTATGCTAGCAATACTTTTCCCTTGGTACCCATTTTACAATTTCCCTAATTTCAATTGAATTCAACACCTTTTTTTTATTTCCCTTTTTCGGTGTTGATTTTTTCATTTGATTTTTTTGTTGTATTGTGATAGGATTATGTTTCGACTGTGTTTGATAACTTCAGTGCCAATGTAGTAGTCGATGGCAGCACTGTCAATCTTGGCTTATGGGACACTGCTGGTAATTCAATTAATCAAATAGTAAATACGGTTTTCTTTCTTTTTTTTTTTTTGAAATTCTTCGGTCTTTTTTAAGAATTTGGTTATGGAAATACAAGACAAGAAGATTACAACAGATAGAGGCCTCTGAGTTACAGAGGAGCTGATGTTTTTTTATTGGCATTTTCTCTCATAAGCAAAGCTACTTATGAGAACATCTTCAAGAAGGTGATTTGAATTCTTTCTGACATAATGTTAAATATTATGTCGTGGATGTCATGGTAATGATTCTTGCTTTTGTTTTTGTTTTCTTTGCAGTGGCTTCCTGA ATGAGCACAACCAAGTTTATCAAATGTGTCATGCTCGGCGACGGCGCCGTCATAAAGACTTGTATGCTCATTTCTTATGCTAGCAATACTTTTCCCTTGGATTATGTTTCGACTGTGTTTGATAACTTCAGTGCCAATGTAGTAGTCGATGGCAGCACTGTCAATCTTGGCTTATGGGACACTGCTGTGGCTTCCTGA ATGAGCACAACCAAGTTTATCAAATGTGTCATGCTCGGCGACGGCGCCGTCATAAAGACTTGTATGCTCATTTCTTATGCTAGCAATACTTTTCCCTTGGATTATGTTTCGACTGTGTTTGATAACTTCAGTGCCAATGTAGTAGTCGATGGCAGCACTGTCAATCTTGGCTTATGGGACACTGCTGTGGCTTCCTGA MSTTKFIKCVMLGDGAVIKTCMLISYASNTFPLDYVSTVFDNFSANVVVDGSTVNLGLWDTAVAS Homology
BLAST of Cmc11g0303371 vs. NCBI nr
Match: KAA0054720.1 (Rac-like GTP-binding protein RAC2 [Cucumis melo var. makuwa] >TYJ95611.1 Rac-like GTP-binding protein RAC2 [Cucumis melo var. makuwa]) HSP 1 Score: 117.9 bits (294), Expect = 3.4e-23 Identity = 58/61 (95.08%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Cmc11g0303371 vs. NCBI nr
Match: XP_003539954.1 (rac-like GTP-binding protein RAC2 [Glycine max] >XP_028193662.1 rac-like GTP-binding protein RAC2 [Glycine soja] >KAG4967824.1 hypothetical protein JHK87_033475 [Glycine soja] >KAG4985934.1 hypothetical protein JHK86_033625 [Glycine max] >KAG5119119.1 hypothetical protein JHK82_033539 [Glycine max] >KRH25686.1 hypothetical protein GLYMA_12G120600v4 [Glycine max]) HSP 1 Score: 113.2 bits (282), Expect = 8.3e-22 Identity = 55/62 (88.71%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. NCBI nr
Match: KAG4980297.1 (hypothetical protein JHK85_034255 [Glycine max] >KAG5140107.1 hypothetical protein JHK84_033875 [Glycine max]) HSP 1 Score: 113.2 bits (282), Expect = 8.3e-22 Identity = 55/62 (88.71%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. NCBI nr
Match: RZB75497.1 (Rac-like GTP-binding protein RAC2 [Glycine soja]) HSP 1 Score: 113.2 bits (282), Expect = 8.3e-22 Identity = 55/62 (88.71%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. NCBI nr
Match: KHN41616.1 (Rac-like GTP-binding protein RAC2 [Glycine soja]) HSP 1 Score: 113.2 bits (282), Expect = 8.3e-22 Identity = 55/62 (88.71%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy Swiss-Prot
Match: Q41253 (Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum OX=3635 GN=RAC13 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.1e-24 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy Swiss-Prot
Match: Q38903 (Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana OX=3702 GN=ARAC2 PE=1 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.1e-24 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy Swiss-Prot
Match: Q40220 (Rac-like GTP-binding protein RAC2 OS=Lotus japonicus OX=34305 GN=RAC2 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.1e-24 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy Swiss-Prot
Match: Q41254 (Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum OX=3635 GN=RAC9 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 7.0e-24 Identity = 53/62 (85.48%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy Swiss-Prot
Match: Q6Z7L8 (Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=RAC7 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 9.2e-24 Identity = 53/62 (85.48%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy TrEMBL
Match: A0A5D3BAG9 (Rac-like GTP-binding protein RAC2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold104G00270 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.6e-23 Identity = 58/61 (95.08%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy TrEMBL
Match: A0A0R0H4T5 (Uncharacterized protein OS=Glycine max OX=3847 GN=100782967 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 4.0e-22 Identity = 55/62 (88.71%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy TrEMBL
Match: A0A5D3BQI9 (Rac-like GTP-binding protein RAC2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold29G00090 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 4.0e-22 Identity = 56/61 (91.80%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy TrEMBL
Match: A0A0B2S4H4 (Rac-like GTP-binding protein RAC2 OS=Glycine soja OX=3848 GN=glysoja_042248 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 4.0e-22 Identity = 55/62 (88.71%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. ExPASy TrEMBL
Match: A0A445HNY2 (Rac-like GTP-binding protein RAC2 OS=Glycine soja OX=3848 GN=D0Y65_034096 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 4.0e-22 Identity = 55/62 (88.71%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Cmc11g0303371 vs. TAIR 10
Match: AT5G45970.1 (RAC-like 2 ) HSP 1 Score: 111.3 bits (277), Expect = 2.9e-25 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. TAIR 10
Match: AT1G75840.1 (RAC-like GTP binding protein 5 ) HSP 1 Score: 108.6 bits (270), Expect = 1.9e-24 Identity = 52/62 (83.87%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. TAIR 10
Match: AT4G35020.1 (RAC-like 3 ) HSP 1 Score: 106.7 bits (265), Expect = 7.2e-24 Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. TAIR 10
Match: AT4G35020.2 (RAC-like 3 ) HSP 1 Score: 106.7 bits (265), Expect = 7.2e-24 Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Cmc11g0303371 vs. TAIR 10
Match: AT4G35020.3 (RAC-like 3 ) HSP 1 Score: 106.7 bits (265), Expect = 7.2e-24 Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|