
Cmc11g0301511 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACAGCTTGTTCAACCCATTGCTAATGGAGCTTTTGTGTTGAGTATTGACACAGATTTTGATGGCTGTATGAAGTTAATAAGAGAAGTTACAGCAGAATTGCCAATTTATTTAGCTAATTCTTTGAATAGTTTGAGAATTGAAGGACGAAAAACAATAGCTATTGAAATTCTACAATAA ATGGCACAGCTTGTTCAACCCATTGCTAATGGAGCTTTTGTGTTGAGTATTGACACAGATTTTGATGGCTGTATGAAGTTAATAAGAGAAGTTACAGCAGAATTGCCAATTTATTTAGCTAATTCTTTGAATAGTTTGAGAATTGAAGGACGAAAAACAATAGCTATTGAAATTCTACAATAA ATGGCACAGCTTGTTCAACCCATTGCTAATGGAGCTTTTGTGTTGAGTATTGACACAGATTTTGATGGCTGTATGAAGTTAATAAGAGAAGTTACAGCAGAATTGCCAATTTATTTAGCTAATTCTTTGAATAGTTTGAGAATTGAAGGACGAAAAACAATAGCTATTGAAATTCTACAATAA MAQLVQPIANGAFVLSIDTDFDGCMKLIREVTAELPIYLANSLNSLRIEGRKTIAIEILQ Homology
BLAST of Cmc11g0301511 vs. NCBI nr
Match: XP_021804962.1 (threonine synthase 1, chloroplastic-like [Prunus avium]) HSP 1 Score: 114.8 bits (286), Expect = 2.6e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. NCBI nr
Match: XP_022960888.1 (threonine synthase, chloroplastic [Cucurbita moschata] >KAG7023681.1 hypothetical protein SDJN02_14707, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 114.4 bits (285), Expect = 3.4e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. NCBI nr
Match: XP_024180086.1 (threonine synthase 1, chloroplastic [Rosa chinensis] >PRQ46918.1 putative threonine synthase [Rosa chinensis]) HSP 1 Score: 114.4 bits (285), Expect = 3.4e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. NCBI nr
Match: XP_030445371.1 (threonine synthase 1, chloroplastic-like [Syzygium oleosum]) HSP 1 Score: 114.4 bits (285), Expect = 3.4e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. NCBI nr
Match: XP_012076993.1 (threonine synthase 1, chloroplastic [Jatropha curcas] >KDP33877.1 hypothetical protein JCGZ_07448 [Jatropha curcas]) HSP 1 Score: 114.4 bits (285), Expect = 3.4e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy Swiss-Prot
Match: Q9S7B5 (Threonine synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TS1 PE=1 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 5.9e-25 Identity = 56/60 (93.33%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy Swiss-Prot
Match: Q9MT28 (Threonine synthase, chloroplastic OS=Solanum tuberosum OX=4113 PE=2 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-24 Identity = 56/60 (93.33%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy Swiss-Prot
Match: Q9SSP5 (Threonine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TS2 PE=1 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 2.2e-24 Identity = 56/60 (93.33%), Postives = 58/60 (96.67%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy Swiss-Prot
Match: P09123 (Threonine synthase OS=Bacillus sp. (strain ULM1) OX=231717 GN=thrC PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-08 Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy Swiss-Prot
Match: A0R220 (Threonine synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=thrC PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-08 Identity = 28/60 (46.67%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy TrEMBL
Match: A0A6P5RQU7 (Threonine synthase OS=Prunus avium OX=42229 GN=LOC110749211 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.3e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy TrEMBL
Match: A0A6J1JK49 (Threonine synthase OS=Cucurbita maxima OX=3661 GN=LOC111485156 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.7e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy TrEMBL
Match: A0A059CM73 (Threonine synthase OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_C00846 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.7e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy TrEMBL
Match: A0A2P6RKG3 (Threonine synthase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr2g0094161 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.7e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. ExPASy TrEMBL
Match: A0A5A7UKY2 (Threonine synthase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold181G001890 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.7e-22 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. TAIR 10
Match: AT4G29840.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein ) HSP 1 Score: 114.0 bits (284), Expect = 4.2e-26 Identity = 56/60 (93.33%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cmc11g0301511 vs. TAIR 10
Match: AT1G72810.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein ) HSP 1 Score: 112.1 bits (279), Expect = 1.6e-25 Identity = 56/60 (93.33%), Postives = 58/60 (96.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|