
Cmc11g0299051 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTAACATTCCCTATGCTTCTGCTGTTAGAAGCCTGATGTATGTAATGTTATGTACTAGACCTCACATTTGCTATTCAGTAGGGATGGTTAGTAGATATCAGTCCAATCCTGGACGTGATCATTGGACAGCCGTTAAGAATATTCTAAAATATCTTAGAAGAACAAAAGACTACATGCTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCTGATTTTCAATTTGATAAAGATGCTAGAAAGTCTACATCGAGATCAGTTTTCACTCTGAATGGAGGAGCAGTAGTATAG ATGAGTAACATTCCCTATGCTTCTGCTGTTAGAAGCCTGATGTATGTAATGTTATGTACTAGACCTCACATTTGCTATTCAGTAGGGATGGTTAGTAGATATCAGTCCAATCCTGGACGTGATCATTGGACAGCCGTTAAGAATATTCTAAAATATCTTAGAAGAACAAAAGACTACATGCTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCTGATTTTCAATTTGATAAAGATGCTAGAAAGTCTACATCGAGATCAGTTTTCACTCTGAATGGAGGAGCAGTAGTATAG ATGAGTAACATTCCCTATGCTTCTGCTGTTAGAAGCCTGATGTATGTAATGTTATGTACTAGACCTCACATTTGCTATTCAGTAGGGATGGTTAGTAGATATCAGTCCAATCCTGGACGTGATCATTGGACAGCCGTTAAGAATATTCTAAAATATCTTAGAAGAACAAAAGACTACATGCTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCTGATTTTCAATTTGATAAAGATGCTAGAAAGTCTACATCGAGATCAGTTTTCACTCTGAATGGAGGAGCAGTAGTATAG MSNIPYASAVRSLMYVMLCTRPHICYSVGMVSRYQSNPGRDHWTAVKNILKYLRRTKDYMLVYGSKDLILTGYTDSDFQFDKDARKSTSRSVFTLNGGAVV Homology
BLAST of Cmc11g0299051 vs. NCBI nr
Match: KAA0061994.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 208.4 bits (529), Expect = 2.9e-50 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cmc11g0299051 vs. NCBI nr
Match: KAA0062116.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 189.9 bits (481), Expect = 1.1e-44 Identity = 93/101 (92.08%), Postives = 94/101 (93.07%), Query Frame = 0
BLAST of Cmc11g0299051 vs. NCBI nr
Match: TYK04573.1 (zinc finger BED domain-containing protein RICESLEEPER 2-like [Cucumis melo var. makuwa]) HSP 1 Score: 189.5 bits (480), Expect = 1.4e-44 Identity = 93/101 (92.08%), Postives = 95/101 (94.06%), Query Frame = 0
BLAST of Cmc11g0299051 vs. NCBI nr
Match: KAA0051985.1 (zinc finger BED domain-containing protein RICESLEEPER 2-like [Cucumis melo var. makuwa]) HSP 1 Score: 189.5 bits (480), Expect = 1.4e-44 Identity = 93/101 (92.08%), Postives = 95/101 (94.06%), Query Frame = 0
BLAST of Cmc11g0299051 vs. NCBI nr
Match: KAA0063026.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 187.6 bits (475), Expect = 5.4e-44 Identity = 89/101 (88.12%), Postives = 93/101 (92.08%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.6e-25 Identity = 55/100 (55.00%), Postives = 73/100 (73.00%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy Swiss-Prot
Match: P0CV72 (Secreted RxLR effector protein 161 OS=Plasmopara viticola OX=143451 GN=RXLR161 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.9e-18 Identity = 44/101 (43.56%), Postives = 69/101 (68.32%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 68.2 bits (165), Expect = 6.2e-11 Identity = 37/97 (38.14%), Postives = 57/97 (58.76%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-07 Identity = 32/85 (37.65%), Postives = 47/85 (55.29%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 1.0e-05 Identity = 31/85 (36.47%), Postives = 47/85 (55.29%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy TrEMBL
Match: A0A5A7V3W4 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold89G002990 PE=4 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 1.4e-50 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy TrEMBL
Match: A0A5A7V6Q6 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold89G004720 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 5.2e-45 Identity = 93/101 (92.08%), Postives = 94/101 (93.07%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy TrEMBL
Match: A0A5A7UE50 (Zinc finger BED domain-containing protein RICESLEEPER 2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold60G004690 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 6.8e-45 Identity = 93/101 (92.08%), Postives = 95/101 (94.06%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy TrEMBL
Match: A0A5D3BXV2 (Zinc finger BED domain-containing protein RICESLEEPER 2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold409G002070 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 6.8e-45 Identity = 93/101 (92.08%), Postives = 95/101 (94.06%), Query Frame = 0
BLAST of Cmc11g0299051 vs. ExPASy TrEMBL
Match: A0A5A7UW06 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold19523G00300 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 2.6e-44 Identity = 92/101 (91.09%), Postives = 94/101 (93.07%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|