Cmc10g0281001 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGAATTGCCTAGGTGCATTAGATGGCACGTACATAAAAGTCAACGTTCCAGCAAGTGACCGGGCTAGGTATAGAACACGCAAGGGGGAGGTGGCCACAAATGTACTTGGCGTGTGTGACACGAAAGGAGATTTTGTTTACGTACTTGCCGGTTGGGAAGGATCAGCTGCGGACTCACGCATCCTCCGTGATGCCCTTTCAAGACCTAATAGGCTTAAGGTGCCCAAGGGTAAGTAA ATGCAGAATTGCCTAGGTGCATTAGATGGCACGTACATAAAAGTCAACGTTCCAGCAAGTGACCGGGCTAGGTATAGAACACGCAAGGGGGAGGTGGCCACAAATGTACTTGGCGTGTGTGACACGAAAGGAGATTTTGTTTACGTACTTGCCGGTTGGGAAGGATCAGCTGCGGACTCACGCATCCTCCGTGATGCCCTTTCAAGACCTAATAGGCTTAAGGTGCCCAAGGGTAAGTAA ATGCAGAATTGCCTAGGTGCATTAGATGGCACGTACATAAAAGTCAACGTTCCAGCAAGTGACCGGGCTAGGTATAGAACACGCAAGGGGGAGGTGGCCACAAATGTACTTGGCGTGTGTGACACGAAAGGAGATTTTGTTTACGTACTTGCCGGTTGGGAAGGATCAGCTGCGGACTCACGCATCCTCCGTGATGCCCTTTCAAGACCTAATAGGCTTAAGGTGCCCAAGGGTAAGTAA MQNCLGALDGTYIKVNVPASDRARYRTRKGEVATNVLGVCDTKGDFVYVLAGWEGSAADSRILRDALSRPNRLKVPKGK Homology
BLAST of Cmc10g0281001 vs. NCBI nr
Match: KAA0063126.1 (retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 162.5 bits (410), Expect = 1.4e-36 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. NCBI nr
Match: KAA0054690.1 (retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 162.5 bits (410), Expect = 1.4e-36 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. NCBI nr
Match: KAA0035620.1 (retrotransposon protein [Cucumis melo var. makuwa] >KAA0038121.1 retrotransposon protein [Cucumis melo var. makuwa] >KAA0041646.1 retrotransposon protein [Cucumis melo var. makuwa] >KAA0047363.1 retrotransposon protein [Cucumis melo var. makuwa] >KAA0048378.1 retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 160.6 bits (405), Expect = 5.5e-36 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. NCBI nr
Match: KAA0046727.1 (retrotransposon protein [Cucumis melo var. makuwa] >KAA0052100.1 retrotransposon protein [Cucumis melo var. makuwa] >KAA0056032.1 retrotransposon protein [Cucumis melo var. makuwa] >KAA0059561.1 retrotransposon protein [Cucumis melo var. makuwa] >KAA0065497.1 retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 160.6 bits (405), Expect = 5.5e-36 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. NCBI nr
Match: KAA0051057.1 (retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 160.6 bits (405), Expect = 5.5e-36 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. ExPASy TrEMBL
Match: A0A5A7UHD9 (Retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold24G005150 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 7.0e-37 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. ExPASy TrEMBL
Match: A0A5A7V9K9 (Retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold1724G00010 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 7.0e-37 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. ExPASy TrEMBL
Match: A0A5A7TXW1 (Retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold298G00370 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.7e-36 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. ExPASy TrEMBL
Match: A0A5D3BDX0 (Retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1112G00360 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.7e-36 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. ExPASy TrEMBL
Match: A0A5A7U9H2 (Retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold678G00110 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.7e-36 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of Cmc10g0281001 vs. TAIR 10
Match: AT5G28950.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41980.1); Has 448 Blast hits to 446 proteins in 74 species: Archae - 0; Bacteria - 0; Metazoa - 31; Fungi - 21; Plants - 396; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 79.7 bits (195), Expect = 1.1e-15 Identity = 36/77 (46.75%), Postives = 54/77 (70.13%), Query Frame = 0
BLAST of Cmc10g0281001 vs. TAIR 10
Match: AT5G41980.1 (CONTAINS InterPro DOMAIN/s: Putative harbinger transposase-derived nuclease (InterPro:IPR006912); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G43722.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). ) HSP 1 Score: 70.9 bits (172), Expect = 5.3e-13 Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of Cmc10g0281001 vs. TAIR 10
Match: AT1G43722.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G28730.1); Has 924 Blast hits to 912 proteins in 109 species: Archae - 0; Bacteria - 0; Metazoa - 222; Fungi - 31; Plants - 661; Viruses - 0; Other Eukaryotes - 10 (source: NCBI BLink). ) HSP 1 Score: 48.9 bits (115), Expect = 2.2e-06 Identity = 22/72 (30.56%), Postives = 37/72 (51.39%), Query Frame = 0
BLAST of Cmc10g0281001 vs. TAIR 10
Match: AT5G35695.1 (CONTAINS InterPro DOMAIN/s: Putative harbinger transposase-derived nuclease (InterPro:IPR006912); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41980.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 42.0 bits (97), Expect = 2.7e-04 Identity = 17/24 (70.83%), Postives = 21/24 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
|