Cmc10g0276701 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAGTTCAACTAGACGTTAGTTTGTATGGAGCTTTCCTTCATGGATGTGGATTATACTGGAGGTTCGATCTCAGAGAAGTTGTAGTCAGGGAAATGCTACAGCTACATCCAAATGAAGCTTGCTATTATGTGCTCTTACCTAACCTTTATGCTTCATATGGGAAATGGGGTCAAGTTAATGAGGCGAGAGATTTGATGCTTCAAAGAGGTTTAAACAAAGTCCCAAGGTATAGCCTAGTAGAAACTAATGCAAGTGTGTTATTTTATTAG ATGCCAGTTCAACTAGACGTTAGTTTGTATGGAGCTTTCCTTCATGGATGTGGATTATACTGGAGGTTCGATCTCAGAGAAGTTGTAGTCAGGGAAATGCTACAGCTACATCCAAATGAAGCTTGCTATTATGTGCTCTTACCTAACCTTTATGCTTCATATGGGAAATGGGGTCAAGTTAATGAGGCGAGAGATTTGATGCTTCAAAGAGGTTTAAACAAAGTCCCAAGGTATAGCCTAGTAGAAACTAATGCAAGTGTGTTATTTTATTAG ATGCCAGTTCAACTAGACGTTAGTTTGTATGGAGCTTTCCTTCATGGATGTGGATTATACTGGAGGTTCGATCTCAGAGAAGTTGTAGTCAGGGAAATGCTACAGCTACATCCAAATGAAGCTTGCTATTATGTGCTCTTACCTAACCTTTATGCTTCATATGGGAAATGGGGTCAAGTTAATGAGGCGAGAGATTTGATGCTTCAAAGAGGTTTAAACAAAGTCCCAAGGTATAGCCTAGTAGAAACTAATGCAAGTGTGTTATTTTATTAG MPVQLDVSLYGAFLHGCGLYWRFDLREVVVREMLQLHPNEACYYVLLPNLYASYGKWGQVNEARDLMLQRGLNKVPRYSLVETNASVLFY Homology
BLAST of Cmc10g0276701 vs. NCBI nr
Match: XP_008456885.1 (PREDICTED: pentatricopeptide repeat-containing protein At2g03380, mitochondrial [Cucumis melo] >XP_016902050.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03380, mitochondrial [Cucumis melo] >XP_016902051.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03380, mitochondrial [Cucumis melo] >XP_016902052.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03380, mitochondrial [Cucumis melo]) HSP 1 Score: 169.9 bits (429), Expect = 1.0e-38 Identity = 81/90 (90.00%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of Cmc10g0276701 vs. NCBI nr
Match: XP_031742318.1 (pentatricopeptide repeat-containing protein At2g03380, mitochondrial [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 2.5e-37 Identity = 79/90 (87.78%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of Cmc10g0276701 vs. NCBI nr
Match: XP_038893238.1 (pentatricopeptide repeat-containing protein At2g03380, mitochondrial [Benincasa hispida]) HSP 1 Score: 164.1 bits (414), Expect = 5.7e-37 Identity = 76/90 (84.44%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of Cmc10g0276701 vs. NCBI nr
Match: TYK25892.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 164.1 bits (414), Expect = 5.7e-37 Identity = 78/85 (91.76%), Postives = 78/85 (91.76%), Query Frame = 0
BLAST of Cmc10g0276701 vs. NCBI nr
Match: KAE8648006.1 (hypothetical protein Csa_021412 [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 9.7e-37 Identity = 77/89 (86.52%), Postives = 80/89 (89.89%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy Swiss-Prot
Match: Q9ZQ74 (Pentatricopeptide repeat-containing protein At2g03380, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E47 PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.8e-25 Identity = 48/82 (58.54%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy Swiss-Prot
Match: Q9SR82 (Putative pentatricopeptide repeat-containing protein At3g08820 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H84 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 5.9e-13 Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy Swiss-Prot
Match: Q9SJZ3 (Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E28 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.3e-12 Identity = 30/87 (34.48%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy Swiss-Prot
Match: O81767 (Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana OX=3702 GN=EMB2758 PE=3 SV=2) HSP 1 Score: 73.2 bits (178), Expect = 1.7e-12 Identity = 34/91 (37.36%), Postives = 53/91 (58.24%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy Swiss-Prot
Match: Q9SN39 (Pentatricopeptide repeat-containing protein DOT4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DOT4 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 3.8e-12 Identity = 34/87 (39.08%), Postives = 47/87 (54.02%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy TrEMBL
Match: A0A1S4E1F1 (pentatricopeptide repeat-containing protein At2g03380, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103496696 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 5.0e-39 Identity = 81/90 (90.00%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy TrEMBL
Match: A0A0A0KP01 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G189940 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 1.2e-37 Identity = 79/90 (87.78%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy TrEMBL
Match: A0A5D3DQT2 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold436G001190 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 2.7e-37 Identity = 78/85 (91.76%), Postives = 78/85 (91.76%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy TrEMBL
Match: A0A6J1KBI2 (pentatricopeptide repeat-containing protein At2g03380, mitochondrial OS=Cucurbita maxima OX=3661 GN=LOC111492392 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 3.3e-35 Identity = 73/90 (81.11%), Postives = 79/90 (87.78%), Query Frame = 0
BLAST of Cmc10g0276701 vs. ExPASy TrEMBL
Match: A0A6J1DCB9 (pentatricopeptide repeat-containing protein At2g03380, mitochondrial isoform X2 OS=Momordica charantia OX=3673 GN=LOC111018771 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 2.2e-34 Identity = 71/90 (78.89%), Postives = 80/90 (88.89%), Query Frame = 0
BLAST of Cmc10g0276701 vs. TAIR 10
Match: AT2G03380.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 114.0 bits (284), Expect = 6.3e-26 Identity = 48/82 (58.54%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Cmc10g0276701 vs. TAIR 10
Match: AT3G08820.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 74.7 bits (182), Expect = 4.2e-14 Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 0
BLAST of Cmc10g0276701 vs. TAIR 10
Match: AT2G22410.1 (SLOW GROWTH 1 ) HSP 1 Score: 73.6 bits (179), Expect = 9.4e-14 Identity = 30/87 (34.48%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of Cmc10g0276701 vs. TAIR 10
Match: AT4G33990.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 73.2 bits (178), Expect = 1.2e-13 Identity = 34/91 (37.36%), Postives = 53/91 (58.24%), Query Frame = 0
BLAST of Cmc10g0276701 vs. TAIR 10
Match: AT4G18750.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 72.0 bits (175), Expect = 2.7e-13 Identity = 34/87 (39.08%), Postives = 47/87 (54.02%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
|