
Cmc08g0228311 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCACTGAAAATTGGGTGGGATGGTTCAAGAAATGGGGCGACAAAGACCCTTACAGAACTGCAGAAGATGTAGCATTTTCTGTGGCAAGATTTTTTCAATCTGGCGGCATCTTCAACAATTATTACATGTATCATGGAGGCACCAACTTTGGAAGAACATCGGGAGGTCCATTCATCACTACATCTTACGATTACAACGCCCCACTTGATGAGTATGGGAACTTGAATCAACCTAAATGGGGGCATCTCAAACAACTCCAGCATCAATCAAGTTAG ATGTTCACTGAAAATTGGGTGGGATGGTTCAAGAAATGGGGCGACAAAGACCCTTACAGAACTGCAGAAGATGTAGCATTTTCTGTGGCAAGATTTTTTCAATCTGGCGGCATCTTCAACAATTATTACATGTATCATGGAGGCACCAACTTTGGAAGAACATCGGGAGGTCCATTCATCACTACATCTTACGATTACAACGCCCCACTTGATGAGTATGGGAACTTGAATCAACCTAAATGGGGGCATCTCAAACAACTCCAGCATCAATCAAGTTAG ATGTTCACTGAAAATTGGGTGGGATGGTTCAAGAAATGGGGCGACAAAGACCCTTACAGAACTGCAGAAGATGTAGCATTTTCTGTGGCAAGATTTTTTCAATCTGGCGGCATCTTCAACAATTATTACATGTATCATGGAGGCACCAACTTTGGAAGAACATCGGGAGGTCCATTCATCACTACATCTTACGATTACAACGCCCCACTTGATGAGTATGGGAACTTGAATCAACCTAAATGGGGGCATCTCAAACAACTCCAGCATCAATCAAGTTAG MFTENWVGWFKKWGDKDPYRTAEDVAFSVARFFQSGGIFNNYYMYHGGTNFGRTSGGPFITTSYDYNAPLDEYGNLNQPKWGHLKQLQHQSS Homology
BLAST of Cmc08g0228311 vs. NCBI nr
Match: XP_008437707.1 (PREDICTED: beta-galactosidase 7-like, partial [Cucumis melo]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. NCBI nr
Match: KAA0055105.1 (beta-galactosidase 7-like [Cucumis melo var. makuwa]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. NCBI nr
Match: KAE8650649.1 (hypothetical protein Csa_023687 [Cucumis sativus]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. NCBI nr
Match: XP_031741738.1 (beta-galactosidase 7-like [Cucumis sativus]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. NCBI nr
Match: XP_031741737.1 (beta-galactosidase 15-like [Cucumis sativus]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy Swiss-Prot
Match: P49676 (Beta-galactosidase OS=Brassica oleracea OX=3712 PE=2 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.2e-42 Identity = 74/87 (85.06%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy Swiss-Prot
Match: Q9SCV5 (Beta-galactosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BGAL7 PE=2 SV=2) HSP 1 Score: 171.8 bits (434), Expect = 3.6e-42 Identity = 73/87 (83.91%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy Swiss-Prot
Match: Q9C6W4 (Beta-galactosidase 15 OS=Arabidopsis thaliana OX=3702 GN=BGAL15 PE=2 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 6.4e-39 Identity = 68/87 (78.16%), Postives = 78/87 (89.66%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy Swiss-Prot
Match: Q8RUV9 (Beta-galactosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0533400 PE=2 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 3.3e-35 Identity = 64/87 (73.56%), Postives = 74/87 (85.06%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy Swiss-Prot
Match: Q9FN08 (Beta-galactosidase 10 OS=Arabidopsis thaliana OX=3702 GN=BGAL10 PE=2 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 4.3e-35 Identity = 65/87 (74.71%), Postives = 73/87 (83.91%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy TrEMBL
Match: A0A5A7UNA7 (Beta-galactosidase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold480G001360 PE=3 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 5.1e-47 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy TrEMBL
Match: A0A5A7UJD2 (Beta-galactosidase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold231G00340 PE=3 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 5.1e-47 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy TrEMBL
Match: A0A5A7V9Y9 (Beta-galactosidase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold130G00750 PE=3 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 5.1e-47 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy TrEMBL
Match: A0A5A7UN87 (Beta-galactosidase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold231G00310 PE=3 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 5.1e-47 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. ExPASy TrEMBL
Match: A0A0A0M006 (Beta-galactosidase OS=Cucumis sativus OX=3659 GN=Csa_1G650110 PE=3 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 5.1e-47 Identity = 86/87 (98.85%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of Cmc08g0228311 vs. TAIR 10
Match: AT5G20710.1 (beta-galactosidase 7 ) HSP 1 Score: 171.8 bits (434), Expect = 2.6e-43 Identity = 73/87 (83.91%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Cmc08g0228311 vs. TAIR 10
Match: AT1G31740.1 (beta-galactosidase 15 ) HSP 1 Score: 161.0 bits (406), Expect = 4.6e-40 Identity = 68/87 (78.16%), Postives = 78/87 (89.66%), Query Frame = 0
BLAST of Cmc08g0228311 vs. TAIR 10
Match: AT5G63810.1 (beta-galactosidase 10 ) HSP 1 Score: 148.3 bits (373), Expect = 3.1e-36 Identity = 65/87 (74.71%), Postives = 73/87 (83.91%), Query Frame = 0
BLAST of Cmc08g0228311 vs. TAIR 10
Match: AT2G28470.1 (beta-galactosidase 8 ) HSP 1 Score: 147.1 bits (370), Expect = 6.8e-36 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 0
BLAST of Cmc08g0228311 vs. TAIR 10
Match: AT2G28470.2 (beta-galactosidase 8 ) HSP 1 Score: 147.1 bits (370), Expect = 6.8e-36 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|