
Cmc08g0227741 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTAACATTCCCTATGCTTCTACTGTTGGGAGTCTGATATATGCAATGTTATGTACTAGACCTGACATTTGCTATTCGGTGGGGATAGTTAGTAGATATCAGTCCAATCCTGGACATGATCACTGGACAGTCGTTAAGAATATTCTAAAATATCTTAGAAGAACAAAAGACTACATGCTCGTGTATGGTTTTAAGGATCTGATCCTTACTAGATACACTGACTCCGATTTTCAAACTGATAAAGATGCTAGAAAGTCTATATCCGGATCAGTTTTCACTCTGAACAGAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGTATTGCCGACTCCACTATGAAAGCTGAATATATAGTTGTCTGTGAAGCAACGAAAGAAGCAATATGA ATGAGTAACATTCCCTATGCTTCTACTGTTGGGAGTCTGATATATGCAATGTTATGTACTAGACCTGACATTTGCTATTCGGTGGGGATAGTTAGTAGATATCAGTCCAATCCTGGACATGATCACTGGACAGTCGTTAAGAATATTCTAAAATATCTTAGAAGAACAAAAGACTACATGCTCGTGTATGGTTTTAAGGATCTGATCCTTACTAGATACACTGACTCCGATTTTCAAACTGATAAAGATGCTAGAAAGTCTATATCCGGATCAGTTTTCACTCTGAACAGAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGTATTGCCGACTCCACTATGAAAGCTGAATATATAGTTGTCTGTGAAGCAACGAAAGAAGCAATATGA ATGAGTAACATTCCCTATGCTTCTACTGTTGGGAGTCTGATATATGCAATGTTATGTACTAGACCTGACATTTGCTATTCGGTGGGGATAGTTAGTAGATATCAGTCCAATCCTGGACATGATCACTGGACAGTCGTTAAGAATATTCTAAAATATCTTAGAAGAACAAAAGACTACATGCTCGTGTATGGTTTTAAGGATCTGATCCTTACTAGATACACTGACTCCGATTTTCAAACTGATAAAGATGCTAGAAAGTCTATATCCGGATCAGTTTTCACTCTGAACAGAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGTATTGCCGACTCCACTATGAAAGCTGAATATATAGTTGTCTGTGAAGCAACGAAAGAAGCAATATGA MSNIPYASTVGSLIYAMLCTRPDICYSVGIVSRYQSNPGHDHWTVVKNILKYLRRTKDYMLVYGFKDLILTRYTDSDFQTDKDARKSISGSVFTLNRGAVVWRSIKQSCIADSTMKAEYIVVCEATKEAI Homology
BLAST of Cmc08g0227741 vs. NCBI nr
Match: KAA0026227.1 (gag/pol protein [Cucumis melo var. makuwa] >TYK30725.1 gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 234.2 bits (596), Expect = 6.4e-58 Identity = 114/130 (87.69%), Postives = 119/130 (91.54%), Query Frame = 0
BLAST of Cmc08g0227741 vs. NCBI nr
Match: TYK06386.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 231.9 bits (590), Expect = 3.2e-57 Identity = 113/130 (86.92%), Postives = 117/130 (90.00%), Query Frame = 0
BLAST of Cmc08g0227741 vs. NCBI nr
Match: TYK29682.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 231.5 bits (589), Expect = 4.2e-57 Identity = 113/130 (86.92%), Postives = 117/130 (90.00%), Query Frame = 0
BLAST of Cmc08g0227741 vs. NCBI nr
Match: KAA0063026.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 231.1 bits (588), Expect = 5.4e-57 Identity = 110/130 (84.62%), Postives = 118/130 (90.77%), Query Frame = 0
BLAST of Cmc08g0227741 vs. NCBI nr
Match: KAA0032993.1 (gag/pol protein [Cucumis melo var. makuwa] >TYK21973.1 gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 230.3 bits (586), Expect = 9.3e-57 Identity = 112/130 (86.15%), Postives = 117/130 (90.00%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.7e-32 Identity = 69/130 (53.08%), Postives = 89/130 (68.46%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy Swiss-Prot
Match: P0CV72 (Secreted RxLR effector protein 161 OS=Plasmopara viticola OX=143451 GN=RXLR161 PE=2 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 4.8e-24 Identity = 55/131 (41.98%), Postives = 87/131 (66.41%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 89.4 bits (220), Expect = 3.4e-17 Identity = 49/133 (36.84%), Postives = 81/133 (60.90%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 8.5e-13 Identity = 44/124 (35.48%), Postives = 65/124 (52.42%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 8.0e-11 Identity = 43/124 (34.68%), Postives = 65/124 (52.42%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy TrEMBL
Match: A0A5A7SNE2 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold343G00570 PE=4 SV=1) HSP 1 Score: 234.2 bits (596), Expect = 3.1e-58 Identity = 114/130 (87.69%), Postives = 119/130 (91.54%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy TrEMBL
Match: A0A5D3C7T2 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold163G00810 PE=4 SV=1) HSP 1 Score: 231.9 bits (590), Expect = 1.5e-57 Identity = 113/130 (86.92%), Postives = 117/130 (90.00%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy TrEMBL
Match: A0A5D3E173 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold64G00320 PE=4 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 2.0e-57 Identity = 113/130 (86.92%), Postives = 117/130 (90.00%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy TrEMBL
Match: A0A5A7V9B0 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold468G001330 PE=4 SV=1) HSP 1 Score: 231.1 bits (588), Expect = 2.6e-57 Identity = 110/130 (84.62%), Postives = 118/130 (90.77%), Query Frame = 0
BLAST of Cmc08g0227741 vs. ExPASy TrEMBL
Match: A0A5D3DEL0 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold482G00020 PE=4 SV=1) HSP 1 Score: 230.3 bits (586), Expect = 4.5e-57 Identity = 112/130 (86.15%), Postives = 117/130 (90.00%), Query Frame = 0
BLAST of Cmc08g0227741 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 65.9 bits (159), Expect = 2.8e-11 Identity = 40/124 (32.26%), Postives = 66/124 (53.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|