
Cmc06g0171361 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGTTTAATCCTCCCTTCAATGCAGGCAAGAATTTTGGCTCTTAATGCCTCATATTTTCTAAAAGCCGGTGGTCATTTTGTTATATCAATCAAGGTGAGTCACAGTCAACTTTTTGATAAAAGTGAAAGATGGTATAGTATAACCCATACACCCAAAGATGATTTGTTTTATATTTAACTTTGTAGGCCAACTGCATAGACTCTACCGTTCCAGCAGAGGCAGTGTTTGCAAGTGAGGTGAATAAGTTAAAAGCAGATCAGTTCAAACTGACTGAGCAAGTAACACTTGAACCATTCGAGCGAGATCATGCCTGTGTTGTCGGTATTTATCGGGCGCCAAAGAAACAAAAGGCTGCTGCCTAG ATGCGTTTAATCCTCCCTTCAATGCAGGCAAGAATTTTGGCTCTTAATGCCTCATATTTTCTAAAAGCCGGTGGTCATTTTGTTATATCAATCAAGGCCAACTGCATAGACTCTACCGTTCCAGCAGAGGCAGTGTTTGCAAGTGAGGTGAATAAGTTAAAAGCAGATCAGTTCAAACTGACTGAGCAAGTAACACTTGAACCATTCGAGCGAGATCATGCCTGTGTTGTCGGTATTTATCGGGCGCCAAAGAAACAAAAGGCTGCTGCCTAG ATGCGTTTAATCCTCCCTTCAATGCAGGCAAGAATTTTGGCTCTTAATGCCTCATATTTTCTAAAAGCCGGTGGTCATTTTGTTATATCAATCAAGGCCAACTGCATAGACTCTACCGTTCCAGCAGAGGCAGTGTTTGCAAGTGAGGTGAATAAGTTAAAAGCAGATCAGTTCAAACTGACTGAGCAAGTAACACTTGAACCATTCGAGCGAGATCATGCCTGTGTTGTCGGTATTTATCGGGCGCCAAAGAAACAAAAGGCTGCTGCCTAG MRLILPSMQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFASEVNKLKADQFKLTEQVTLEPFERDHACVVGIYRAPKKQKAAA Homology
BLAST of Cmc06g0171361 vs. NCBI nr
Match: XP_016903173.1 (PREDICTED: mediator of RNA polymerase II transcription subunit 36a-like [Cucumis melo] >TYK15456.1 mediator of RNA polymerase II transcription subunit 36a-like [Cucumis melo var. makuwa]) HSP 1 Score: 161.4 bits (407), Expect = 3.7e-36 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Cmc06g0171361 vs. NCBI nr
Match: KGN57431.2 (hypothetical protein Csa_009607 [Cucumis sativus]) HSP 1 Score: 159.8 bits (403), Expect = 1.1e-35 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Cmc06g0171361 vs. NCBI nr
Match: XP_022922917.1 (probable mediator of RNA polymerase II transcription subunit 36b [Cucurbita moschata]) HSP 1 Score: 159.8 bits (403), Expect = 1.1e-35 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Cmc06g0171361 vs. NCBI nr
Match: XP_023552409.1 (mediator of RNA polymerase II transcription subunit 36a-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 159.8 bits (403), Expect = 1.1e-35 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Cmc06g0171361 vs. NCBI nr
Match: XP_004143621.2 (probable mediator of RNA polymerase II transcription subunit 36b [Cucumis sativus] >KGN50438.1 hypothetical protein Csa_000027 [Cucumis sativus]) HSP 1 Score: 159.8 bits (403), Expect = 1.1e-35 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy Swiss-Prot
Match: Q94AH9 (rRNA 2'-O-methyltransferase fibrillarin 2 OS=Arabidopsis thaliana OX=3702 GN=FIB2 PE=1 SV=2) HSP 1 Score: 137.5 bits (345), Expect = 7.4e-32 Identity = 69/81 (85.19%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy Swiss-Prot
Match: Q9FEF8 (rRNA 2'-O-methyltransferase fibrillarin 1 OS=Arabidopsis thaliana OX=3702 GN=FIB1 PE=1 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.2e-31 Identity = 68/82 (82.93%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy Swiss-Prot
Match: Q8I1F4 (rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila erecta OX=7220 GN=Fib PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.0e-25 Identity = 56/78 (71.79%), Postives = 65/78 (83.33%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy Swiss-Prot
Match: Q9W1V3 (rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila melanogaster OX=7227 GN=Fib PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.8e-25 Identity = 55/78 (70.51%), Postives = 65/78 (83.33%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy Swiss-Prot
Match: P35549 (rRNA 2'-O-methyltransferase fibrillarin OS=Leishmania major OX=5664 PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 2.0e-24 Identity = 57/79 (72.15%), Postives = 64/79 (81.01%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy TrEMBL
Match: A0A5D3CYG2 (Mediator of RNA polymerase II transcription subunit 36a-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold477G00260 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 1.8e-36 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy TrEMBL
Match: A0A1S4E4L3 (mediator of RNA polymerase II transcription subunit 36a-like OS=Cucumis melo OX=3656 GN=LOC103502201 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 1.8e-36 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy TrEMBL
Match: A0A6J1JA27 (probable mediator of RNA polymerase II transcription subunit 36b OS=Cucurbita maxima OX=3661 GN=LOC111483086 PE=3 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 5.2e-36 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy TrEMBL
Match: A0A0A0L9V7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G183360 PE=3 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 5.2e-36 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Cmc06g0171361 vs. ExPASy TrEMBL
Match: A0A0A0KLF9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G174640 PE=3 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 5.2e-36 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of Cmc06g0171361 vs. TAIR 10
Match: AT4G25630.1 (fibrillarin 2 ) HSP 1 Score: 137.5 bits (345), Expect = 5.3e-33 Identity = 69/81 (85.19%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Cmc06g0171361 vs. TAIR 10
Match: AT5G52470.1 (fibrillarin 1 ) HSP 1 Score: 134.0 bits (336), Expect = 5.8e-32 Identity = 68/82 (82.93%), Postives = 71/82 (86.59%), Query Frame = 0
BLAST of Cmc06g0171361 vs. TAIR 10
Match: AT5G52490.1 (Fibrillarin family protein ) HSP 1 Score: 93.6 bits (231), Expect = 8.7e-20 Identity = 46/77 (59.74%), Postives = 58/77 (75.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|