Cmc06g0160231 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGACAACTCTTTCTTTCACTATATCATAAACGGATCTTCCCCTCCACACCAATCACGAGTTTTTCTCCATTCCTCTCGTATATCGTCGTCACACCCTTAATGCTAGGTTTTGAAAAAGACTTTTCATGTCATTCCCATTTAGGTTCGATTCGGATCCCTCCGTTGTTTCCTTTTCCTCCCGCACCTTTTCCTCGAAATGAGAAAGAAGATGGTACACTCGAATTGTATTATTTAAGTGCTTAA ATGAGACAACTCTTTCTTTCACTATATCATAAACGGATCTTCCCCTCCACACCAATCACGAGTTTTTCTCCATTCCTCTCGTATATCGTCGTCACACCCTTAATGCTAGGTTTTGAAAAAGACTTTTCATGTCATTCCCATTTAGGTTCGATTCGGATCCCTCCGTTGTTTCCTTTTCCTCCCGCACCTTTTCCTCGAAATGAGAAAGAAGATGGTACACTCGAATTGTATTATTTAAGTGCTTAA ATGAGACAACTCTTTCTTTCACTATATCATAAACGGATCTTCCCCTCCACACCAATCACGAGTTTTTCTCCATTCCTCTCGTATATCGTCGTCACACCCTTAATGCTAGGTTTTGAAAAAGACTTTTCATGTCATTCCCATTTAGGTTCGATTCGGATCCCTCCGTTGTTTCCTTTTCCTCCCGCACCTTTTCCTCGAAATGAGAAAGAAGATGGTACACTCGAATTGTATTATTTAAGTGCTTAA MRQLFLSLYHKRIFPSTPITSFSPFLSYIVVTPLMLGFEKDFSCHSHLGSIRIPPLFPFPPAPFPRNEKEDGTLELYYLSA Homology
BLAST of Cmc06g0160231 vs. NCBI nr
Match: AEN56106.1 (cytochrome c biogenesis B [Cucumis melo subsp. melo] >AZP40281.1 cytochrome c biogenesis B [Cucumis melo var. momordica]) HSP 1 Score: 169.1 bits (427), Expect = 1.6e-38 Identity = 79/81 (97.53%), Postives = 80/81 (98.77%), Query Frame = 0
BLAST of Cmc06g0160231 vs. NCBI nr
Match: YP_009913630.1 (cytochrome c biogenesis B [Luffa acutangula] >QLJ93004.1 cytochrome c biogenesis B [Luffa acutangula]) HSP 1 Score: 169.1 bits (427), Expect = 1.6e-38 Identity = 79/81 (97.53%), Postives = 80/81 (98.77%), Query Frame = 0
BLAST of Cmc06g0160231 vs. NCBI nr
Match: YP_004849329.1 (cytochrome c biogenesis B [Cucumis sativus] >ADZ10756.1 cytochrome c biogenesis B [Cucumis sativus]) HSP 1 Score: 167.5 bits (423), Expect = 4.6e-38 Identity = 78/81 (96.30%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cmc06g0160231 vs. NCBI nr
Match: YP_009522824.1 (cytochrome c biogenesis B [Styphnolobium japonicum] >AXQ37254.1 cytochrome c biogenesis B [Styphnolobium japonicum]) HSP 1 Score: 166.0 bits (419), Expect = 1.3e-37 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cmc06g0160231 vs. NCBI nr
Match: QDH82080.1 (cytochrome c biogenesis B [Broussonetia luzonica] >QDH82105.1 cytochrome c biogenesis B [Broussonetia monoica] >QDH82130.1 cytochrome c biogenesis B [Trophis scandens] >QDH82154.1 cytochrome c biogenesis B [Broussonetia kurzii] >QDH82178.1 cytochrome c biogenesis B [Broussonetia kaempferi] >QDH82203.1 cytochrome c biogenesis B [Broussonetia papyrifera]) HSP 1 Score: 166.0 bits (419), Expect = 1.3e-37 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cmc06g0160231 vs. ExPASy Swiss-Prot
Match: P93280 (Putative cytochrome c biogenesis ccmB-like mitochondrial protein OS=Arabidopsis thaliana OX=3702 GN=CCMB PE=2 SV=2) HSP 1 Score: 117.1 bits (292), Expect = 9.4e-26 Identity = 61/80 (76.25%), Postives = 63/80 (78.75%), Query Frame = 0
BLAST of Cmc06g0160231 vs. ExPASy Swiss-Prot
Match: P38454 (Putative cytochrome c biogenesis ccmB-like mitochondrial protein OS=Marchantia polymorpha OX=3197 GN=CCMB PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 7.2e-18 Identity = 49/80 (61.25%), Postives = 58/80 (72.50%), Query Frame = 0
BLAST of Cmc06g0160231 vs. ExPASy TrEMBL
Match: A0A7D6C7C3 (Cytochrome c biogenesis B OS=Luffa acutangula OX=56866 GN=ccmB PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 7.7e-39 Identity = 79/81 (97.53%), Postives = 80/81 (98.77%), Query Frame = 0
BLAST of Cmc06g0160231 vs. ExPASy TrEMBL
Match: G3EU22 (Cytochrome c biogenesis B OS=Cucumis melo subsp. melo OX=412675 GN=ccmB PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 7.7e-39 Identity = 79/81 (97.53%), Postives = 80/81 (98.77%), Query Frame = 0
BLAST of Cmc06g0160231 vs. ExPASy TrEMBL
Match: A0A3Q9CS08 (Cytochrome c biogenesis B OS=Cucumis melo var. momordica OX=2034244 GN=ccmB PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 7.7e-39 Identity = 79/81 (97.53%), Postives = 80/81 (98.77%), Query Frame = 0
BLAST of Cmc06g0160231 vs. ExPASy TrEMBL
Match: G3EIY1 (Cytochrome c biogenesis B OS=Cucumis sativus OX=3659 GN=ccmB PE=3 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 2.2e-38 Identity = 78/81 (96.30%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cmc06g0160231 vs. ExPASy TrEMBL
Match: A0A142BZ22 (Cytochrome c biogenesis B OS=Ziziphus jujuba OX=326968 GN=ccmB PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 6.5e-38 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cmc06g0160231 vs. TAIR 10
Match: ATMG00110.1 (cytochrome C biogenesis 206 ) HSP 1 Score: 157.1 bits (396), Expect = 5.8e-39 Identity = 74/80 (92.50%), Postives = 75/80 (93.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|