
Cmc04g0095941 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATCAAACATGGGACTTAGTGGACCTTCCCATGGGAAGCAAGCCAATTAGGTGTAAGTGGATCTTCAAAAGAAAAACAAAATCAAATGGGTCAATAGAAAGATACAAGGCTAGATTAGTGGTAGTAGGGTATACCCAGAAACAAGGCATTGATTACTTTGACACATATTCCCCTGTAACTAAGATAACCACAATTAGGGCCTTGATTGCATTAGCTGCCATACATAGCCTTCTTATTCACCAAATGGACATAAAAACTGTCTTTCTAAATGGTGACTTAGAAGAAGAAATTTATATGACACAACCAGAAGGTTTTAAAATTCTTGGCCAAGAAAACAAAGTGTGTAAACTGAGAAAATCCTGTGTAAACTGA ATGAATCAAACATGGGACTTAGTGGACCTTCCCATGGGAAGCAAGCCAATTAGGTGTAAGTGGATCTTCAAAAGAAAAACAAAATCAAATGGGTCAATAGAAAGATACAAGGCTAGATTAGTGGTAGTAGGGTATACCCAGAAACAAGGCATTGATTACTTTGACACATATTCCCCTGTAACTAAGATAACCACAATTAGGGCCTTGATTGCATTAGCTGCCATACATAGCCTTCTTATTCACCAAATGGACATAAAAACTGTCTTTCTAAATGGTGACTTAGAAGAAGAAATTTATATGACACAACCAGAAGGTTTTAAAATTCTTGGCCAAGAAAACAAAGTGTGTAAACTGAGAAAATCCTGTGTAAACTGA ATGAATCAAACATGGGACTTAGTGGACCTTCCCATGGGAAGCAAGCCAATTAGGTGTAAGTGGATCTTCAAAAGAAAAACAAAATCAAATGGGTCAATAGAAAGATACAAGGCTAGATTAGTGGTAGTAGGGTATACCCAGAAACAAGGCATTGATTACTTTGACACATATTCCCCTGTAACTAAGATAACCACAATTAGGGCCTTGATTGCATTAGCTGCCATACATAGCCTTCTTATTCACCAAATGGACATAAAAACTGTCTTTCTAAATGGTGACTTAGAAGAAGAAATTTATATGACACAACCAGAAGGTTTTAAAATTCTTGGCCAAGAAAACAAAGTGTGTAAACTGAGAAAATCCTGTGTAAACTGA MNQTWDLVDLPMGSKPIRCKWIFKRKTKSNGSIERYKARLVVVGYTQKQGIDYFDTYSPVTKITTIRALIALAAIHSLLIHQMDIKTVFLNGDLEEEIYMTQPEGFKILGQENKVCKLRKSCVN Homology
BLAST of Cmc04g0095941 vs. NCBI nr
Match: TYK06518.1 (ty1-copia retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 230.7 bits (587), Expect = 6.8e-57 Identity = 110/121 (90.91%), Postives = 116/121 (95.87%), Query Frame = 0
BLAST of Cmc04g0095941 vs. NCBI nr
Match: PNX71449.1 (retrotransposon-related protein, partial [Trifolium pratense]) HSP 1 Score: 191.0 bits (484), Expect = 6.0e-45 Identity = 86/120 (71.67%), Postives = 104/120 (86.67%), Query Frame = 0
BLAST of Cmc04g0095941 vs. NCBI nr
Match: PHT43509.1 (ATP phosphoribosyltransferase 1, chloroplastic [Capsicum baccatum]) HSP 1 Score: 189.1 bits (479), Expect = 2.3e-44 Identity = 88/120 (73.33%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Cmc04g0095941 vs. NCBI nr
Match: KAD6453934.1 (hypothetical protein E3N88_08640 [Mikania micrantha]) HSP 1 Score: 188.0 bits (476), Expect = 5.0e-44 Identity = 85/120 (70.83%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Cmc04g0095941 vs. NCBI nr
Match: PHT42147.1 (hypothetical protein CQW23_16172 [Capsicum baccatum]) HSP 1 Score: 186.8 bits (473), Expect = 1.1e-43 Identity = 86/120 (71.67%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.7e-34 Identity = 66/120 (55.00%), Postives = 93/120 (77.50%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.3e-26 Identity = 59/121 (48.76%), Postives = 79/121 (65.29%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.7e-26 Identity = 59/121 (48.76%), Postives = 80/121 (66.12%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 109.4 bits (272), Expect = 3.0e-23 Identity = 53/121 (43.80%), Postives = 77/121 (63.64%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy Swiss-Prot
Match: P92520 (Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana OX=3702 GN=AtMg00820 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-13 Identity = 33/72 (45.83%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy TrEMBL
Match: A0A5D3C5T2 (Ty1-copia retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold70G00500 PE=4 SV=1) HSP 1 Score: 230.7 bits (587), Expect = 3.3e-57 Identity = 110/121 (90.91%), Postives = 116/121 (95.87%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy TrEMBL
Match: A0A2K3KYW3 (Retrotransposon-related protein (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g027329 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 2.9e-45 Identity = 86/120 (71.67%), Postives = 104/120 (86.67%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy TrEMBL
Match: A0A2N9EQT1 (Integrase catalytic domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS4851 PE=4 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 4.9e-45 Identity = 86/120 (71.67%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy TrEMBL
Match: A0A2N9H4B0 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS37208 PE=4 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 4.9e-45 Identity = 86/120 (71.67%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Cmc04g0095941 vs. ExPASy TrEMBL
Match: A0A2G2WEA7 (ATP phosphoribosyltransferase 1, chloroplastic OS=Capsicum baccatum OX=33114 GN=CQW23_17534 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 1.1e-44 Identity = 88/120 (73.33%), Postives = 105/120 (87.50%), Query Frame = 0
BLAST of Cmc04g0095941 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 137.9 bits (346), Expect = 5.6e-33 Identity = 62/122 (50.82%), Postives = 89/122 (72.95%), Query Frame = 0
BLAST of Cmc04g0095941 vs. TAIR 10
Match: ATMG00820.1 (Reverse transcriptase (RNA-dependent DNA polymerase) ) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-14 Identity = 33/72 (45.83%), Postives = 50/72 (69.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|