
Cmc04g0094661 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTCAACAACTTGGCCTTGTTGATAAAATTCCAAGGCTTGTTTGTGCACAAGCAGCCAATGCAAATCCTTTGTATTTACATTACAAATCTGGTTGGAAAGATTTCAAGGCTGTGAAAGCAAGTTCAACTTTTGCTTCCGCCATTCAGATTAGAGATCCGGTTTCTATAGACCGAGCTATTTACGCATTGCAGAATTCAAATGGCATTGTTGAGGAAGCAACCGAGGAGGAACTTATGGACGCAATGGCACAAGCTGTCCAGAGCTAG ATGTGTCAACAACTTGGCCTTGTTGATAAAATTCCAAGGCTTGTTTGTGCACAAGCAGCCAATGCAAATCCTTTGTATTTACATTACAAATCTGGTTGGAAAGATTTCAAGGCTGTGAAAGCAAGTTCAACTTTTGCTTCCGCCATTCAGATTAGAGATCCGGTTTCTATAGACCGAGCTATTTACGCATTGCAGAATTCAAATGGCATTGTTGAGGAAGCAACCGAGGAGGAACTTATGGACGCAATGGCACAAGCTGTCCAGAGCTAG ATGTGTCAACAACTTGGCCTTGTTGATAAAATTCCAAGGCTTGTTTGTGCACAAGCAGCCAATGCAAATCCTTTGTATTTACATTACAAATCTGGTTGGAAAGATTTCAAGGCTGTGAAAGCAAGTTCAACTTTTGCTTCCGCCATTCAGATTAGAGATCCGGTTTCTATAGACCGAGCTATTTACGCATTGCAGAATTCAAATGGCATTGTTGAGGAAGCAACCGAGGAGGAACTTATGGACGCAATGGCACAAGCTGTCCAGAGCTAG MCQQLGLVDKIPRLVCAQAANANPLYLHYKSGWKDFKAVKASSTFASAIQIRDPVSIDRAIYALQNSNGIVEEATEEELMDAMAQAVQS Homology
BLAST of Cmc04g0094661 vs. NCBI nr
Match: TYK27135.1 (threonine synthase 1 [Cucumis melo var. makuwa]) HSP 1 Score: 173.3 bits (438), Expect = 9.2e-40 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc04g0094661 vs. NCBI nr
Match: KAA0058933.1 (threonine synthase 1 [Cucumis melo var. makuwa] >TYK23699.1 threonine synthase 1 [Cucumis melo var. makuwa]) HSP 1 Score: 173.3 bits (438), Expect = 9.2e-40 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc04g0094661 vs. NCBI nr
Match: TYJ98378.1 (threonine synthase 1 [Cucumis melo var. makuwa]) HSP 1 Score: 171.8 bits (434), Expect = 2.7e-39 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc04g0094661 vs. NCBI nr
Match: KAA0066465.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein [Cucumis melo var. makuwa]) HSP 1 Score: 171.0 bits (432), Expect = 4.6e-39 Identity = 87/89 (97.75%), Postives = 87/89 (97.75%), Query Frame = 0
BLAST of Cmc04g0094661 vs. NCBI nr
Match: KAA0056033.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein [Cucumis melo var. makuwa]) HSP 1 Score: 170.6 bits (431), Expect = 6.0e-39 Identity = 87/89 (97.75%), Postives = 87/89 (97.75%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy Swiss-Prot
Match: Q9MT28 (Threonine synthase, chloroplastic OS=Solanum tuberosum OX=4113 PE=2 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.8e-37 Identity = 75/86 (87.21%), Postives = 82/86 (95.35%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy Swiss-Prot
Match: Q9S7B5 (Threonine synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TS1 PE=1 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 1.7e-36 Identity = 74/86 (86.05%), Postives = 81/86 (94.19%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy Swiss-Prot
Match: Q9SSP5 (Threonine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TS2 PE=1 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.5e-32 Identity = 71/87 (81.61%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy Swiss-Prot
Match: Q58860 (Threonine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=thrC PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.8e-07 Identity = 26/77 (33.77%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy Swiss-Prot
Match: Q8TQD4 (Threonine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=thrC PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.1e-06 Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy TrEMBL
Match: A0A5A7USM5 (Threonine synthase 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1607G00030 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 4.5e-40 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy TrEMBL
Match: A0A5D3DUZ0 (Threonine synthase 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1920G00050 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 4.5e-40 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy TrEMBL
Match: A0A5D3BJK3 (Threonine synthase 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold232G001170 PE=4 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 1.3e-39 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy TrEMBL
Match: A0A5A7VL42 (Pyridoxal-5'-phosphate-dependent enzyme family protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold21G005660 PE=4 SV=1) HSP 1 Score: 171.0 bits (432), Expect = 2.2e-39 Identity = 87/89 (97.75%), Postives = 87/89 (97.75%), Query Frame = 0
BLAST of Cmc04g0094661 vs. ExPASy TrEMBL
Match: A0A5A7UJB3 (Pyridoxal-5'-phosphate-dependent enzyme family protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold319G001880 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 2.9e-39 Identity = 87/89 (97.75%), Postives = 87/89 (97.75%), Query Frame = 0
BLAST of Cmc04g0094661 vs. TAIR 10
Match: AT4G29840.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein ) HSP 1 Score: 152.9 bits (385), Expect = 1.2e-37 Identity = 74/86 (86.05%), Postives = 81/86 (94.19%), Query Frame = 0
BLAST of Cmc04g0094661 vs. TAIR 10
Match: AT1G72810.1 (Pyridoxal-5'-phosphate-dependent enzyme family protein ) HSP 1 Score: 139.8 bits (351), Expect = 1.1e-33 Identity = 71/87 (81.61%), Postives = 80/87 (91.95%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|