Cmc03g0064941 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGTTAAGACTACATTTCTTCATGGGTATTTAGATAAAGAAATCTATATGGAACAGCCAAAAGGTTTTGAGCAGAAAGGCAAAGAGCATCTGGTGTGTAAATCGAAGAAAAGTCTTTATGGGTTGAAACAAGCACTGAGACAGTGGTACAAGAAGTTTGAGTCAATTATGGGGGAGCAAGGCTACAGAAAAACTACTTTTGATCACTATGTTTTTGTCCATAATTATTTTGATGATGATTTTGTTATATTATTACTCTATGTTGATGATATTTTGATTATTGGCAGGAATATTTCCAGAATTGATAGCTTGAAGAAATAG ATGGATGTTAAGACTACATTTCTTCATGGGTATTTAGATAAAGAAATCTATATGGAACAGCCAAAAGGTTTTGAGCAGAAAGGCAAAGAGCATCTGGTGTGTAAATCGAAGAAAAGTCTTTATGGGTTGAAACAAGCACTGAGACAGTGGTACAAGAAGTTTGAGTCAATTATGGGGGAGCAAGGCTACAGAAAAACTACTTTTGATCACTATGTTTTTGTCCATAATTATTTTGATGATGATTTTGTTATATTATTACTCTATGTTGATGATATTTTGATTATTGGCAGGAATATTTCCAGAATTGATAGCTTGAAGAAATAG ATGGATGTTAAGACTACATTTCTTCATGGGTATTTAGATAAAGAAATCTATATGGAACAGCCAAAAGGTTTTGAGCAGAAAGGCAAAGAGCATCTGGTGTGTAAATCGAAGAAAAGTCTTTATGGGTTGAAACAAGCACTGAGACAGTGGTACAAGAAGTTTGAGTCAATTATGGGGGAGCAAGGCTACAGAAAAACTACTTTTGATCACTATGTTTTTGTCCATAATTATTTTGATGATGATTTTGTTATATTATTACTCTATGTTGATGATATTTTGATTATTGGCAGGAATATTTCCAGAATTGATAGCTTGAAGAAATAG MDVKTTFLHGYLDKEIYMEQPKGFEQKGKEHLVCKSKKSLYGLKQALRQWYKKFESIMGEQGYRKTTFDHYVFVHNYFDDDFVILLLYVDDILIIGRNISRIDSLKK Homology
BLAST of Cmc03g0064941 vs. NCBI nr
Match: RVW88205.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 180.3 bits (456), Expect = 9.1e-42 Identity = 89/107 (83.18%), Postives = 95/107 (88.79%), Query Frame = 0
BLAST of Cmc03g0064941 vs. NCBI nr
Match: RVW24680.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 178.3 bits (451), Expect = 3.4e-41 Identity = 89/107 (83.18%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. NCBI nr
Match: RVW22327.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 178.3 bits (451), Expect = 3.4e-41 Identity = 89/107 (83.18%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. NCBI nr
Match: RVW85908.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 177.2 bits (448), Expect = 7.7e-41 Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. NCBI nr
Match: RVW24009.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 177.2 bits (448), Expect = 7.7e-41 Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.2e-28 Identity = 63/106 (59.43%), Postives = 80/106 (75.47%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.2e-12 Identity = 41/98 (41.84%), Postives = 57/98 (58.16%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-12 Identity = 40/108 (37.04%), Postives = 69/108 (63.89%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.6e-12 Identity = 39/98 (39.80%), Postives = 56/98 (57.14%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy Swiss-Prot
Match: P25600 (Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY5A PE=5 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 2.9e-06 Identity = 31/107 (28.97%), Postives = 57/107 (53.27%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy TrEMBL
Match: A0A438HUT4 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_569 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 4.4e-42 Identity = 89/107 (83.18%), Postives = 95/107 (88.79%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy TrEMBL
Match: A0A438CGI4 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_1683 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.7e-41 Identity = 89/107 (83.18%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy TrEMBL
Match: A0A438CN91 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_3654 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.7e-41 Identity = 89/107 (83.18%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy TrEMBL
Match: A0A438HN89 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_3233 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 3.7e-41 Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. ExPASy TrEMBL
Match: A0A438CLF9 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_2520 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 3.7e-41 Identity = 88/107 (82.24%), Postives = 94/107 (87.85%), Query Frame = 0
BLAST of Cmc03g0064941 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 76.6 bits (187), Expect = 1.3e-14 Identity = 45/110 (40.91%), Postives = 66/110 (60.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|