Cmc02g0049991 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTATTCCTAGAACCATTCATTTTACTGTTGTGTTACGTATTCTTCGCTACATCAAGGGAACCTTGGGGCATGGACTTCAATTTTCTTCTCAATCCTCTCTCATATTATCTGGCTACTCTGATGCAGATTGGGCTGGGGGTCCCATTGATCGACGTTCTACAACAGGTTACTGTTTCTACTTAGTTGATTCTCTCATTTCTTGGCGTAGTAAGAAACAAAGTGTTGTCTCTCGTTCCAGCACTAAATCAGAATATTGTACGCTTGCTGATGCTACCGTTGAACTCATATGGCTTCGTTGGCTTCTTGCTAATATGGGTGTTCCCTAG ATGGCTATTCCTAGAACCATTCATTTTACTGTTGTGTTACGTATTCTTCGCTACATCAAGGGAACCTTGGGGCATGGACTTCAATTTTCTTCTCAATCCTCTCTCATATTATCTGGCTACTCTGATGCAGATTGGGCTGGGGGTCCCATTGATCGACGTTCTACAACAGGTTACTGTTTCTACTTAGTTGATTCTCTCATTTCTTGGCGTAGTAAGAAACAAAGTGTTGTCTCTCGTTCCAGCACTAAATCAGAATATTGTACGCTTGCTGATGCTACCGTTGAACTCATATGGCTTCGTTGGCTTCTTGCTAATATGGGTGTTCCCTAG ATGGCTATTCCTAGAACCATTCATTTTACTGTTGTGTTACGTATTCTTCGCTACATCAAGGGAACCTTGGGGCATGGACTTCAATTTTCTTCTCAATCCTCTCTCATATTATCTGGCTACTCTGATGCAGATTGGGCTGGGGGTCCCATTGATCGACGTTCTACAACAGGTTACTGTTTCTACTTAGTTGATTCTCTCATTTCTTGGCGTAGTAAGAAACAAAGTGTTGTCTCTCGTTCCAGCACTAAATCAGAATATTGTACGCTTGCTGATGCTACCGTTGAACTCATATGGCTTCGTTGGCTTCTTGCTAATATGGGTGTTCCCTAG MAIPRTIHFTVVLRILRYIKGTLGHGLQFSSQSSLILSGYSDADWAGGPIDRRSTTGYCFYLVDSLISWRSKKQSVVSRSSTKSEYCTLADATVELIWLRWLLANMGVP Homology
BLAST of Cmc02g0049991 vs. NCBI nr
Match: XP_016903302.1 (PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Cucumis melo]) HSP 1 Score: 223.0 bits (567), Expect = 1.2e-54 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 0
BLAST of Cmc02g0049991 vs. NCBI nr
Match: KAA0046732.1 (putative mitochondrial protein [Cucumis melo var. makuwa] >TYK14509.1 putative mitochondrial protein [Cucumis melo var. makuwa]) HSP 1 Score: 223.0 bits (567), Expect = 1.2e-54 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 0
BLAST of Cmc02g0049991 vs. NCBI nr
Match: XP_016903443.1 (PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Cucumis melo]) HSP 1 Score: 201.1 bits (510), Expect = 5.1e-48 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc02g0049991 vs. NCBI nr
Match: XP_031742866.1 (uncharacterized protein LOC116404492 [Cucumis sativus]) HSP 1 Score: 199.5 bits (506), Expect = 1.5e-47 Identity = 96/109 (88.07%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc02g0049991 vs. NCBI nr
Match: XP_031742303.1 (uncharacterized protein LOC116404150 [Cucumis sativus]) HSP 1 Score: 199.5 bits (506), Expect = 1.5e-47 Identity = 96/109 (88.07%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy Swiss-Prot
Match: P0CV72 (Secreted RxLR effector protein 161 OS=Plasmopara viticola OX=143451 GN=RXLR161 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.1e-20 Identity = 47/96 (48.96%), Postives = 63/96 (65.62%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy Swiss-Prot
Match: P92519 (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 5.1e-19 Identity = 45/95 (47.37%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.7e-19 Identity = 49/108 (45.37%), Postives = 66/108 (61.11%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.1e-18 Identity = 49/108 (45.37%), Postives = 65/108 (60.19%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 89.0 bits (219), Expect = 3.7e-17 Identity = 44/98 (44.90%), Postives = 66/98 (67.35%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy TrEMBL
Match: A0A5A7TTH3 (Putative mitochondrial protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold15G00240 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 6.0e-55 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy TrEMBL
Match: A0A1S4E503 (uncharacterized mitochondrial protein AtMg00810-like OS=Cucumis melo OX=3656 GN=LOC107992118 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 6.0e-55 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy TrEMBL
Match: A0A1S4E5D2 (uncharacterized mitochondrial protein AtMg00810-like OS=Cucumis melo OX=3656 GN=LOC107992200 PE=4 SV=1) HSP 1 Score: 201.1 bits (510), Expect = 2.4e-48 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy TrEMBL
Match: A0A5A7V9Z8 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold99G00670 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 7.1e-48 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc02g0049991 vs. ExPASy TrEMBL
Match: A0A5A7VIT8 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1017G00050 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 9.3e-48 Identity = 96/109 (88.07%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc02g0049991 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 104.0 bits (258), Expect = 7.8e-23 Identity = 52/106 (49.06%), Postives = 70/106 (66.04%), Query Frame = 0
BLAST of Cmc02g0049991 vs. TAIR 10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 95.1 bits (235), Expect = 3.6e-20 Identity = 45/95 (47.37%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of Cmc02g0049991 vs. TAIR 10
Match: ATMG00240.1 (Gag-Pol-related retrotransposon family protein ) HSP 1 Score: 60.5 bits (145), Expect = 9.9e-10 Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|