
Cmc02g0044071 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGACATCTAAGTCATATAAATAAAGAGATATGTTCATTGATAAGAAAAAATATGACCGGTGATTGGATTGATGAGAAAATCCAATCCTGGGTCTTGAACAGTGATTCAATTGATAATAAAGAAAAAGAATTCTTGATTCAGTTCTCTAACTTAATGATAGAAAAAAGGATTGATCAAATTCTATTGAGTCTGACTCATAGTGATCATTTATCAAAGAATGACTCTGGTTATCAAATGATTGAACAACCAGAAGTAATATACTTACGATACTTAGTTGACATTCATAAAAAATATCTAATGAATTATGAGTTCAATACATCTTATTTAGCAGAAAGATAG ATGAGACATCTAAGTCATATAAATAAAGAGATATGTTCATTGATAAGAAAAAATATGACCGGTGATTGGATTGATGAGAAAATCCAATCCTGGGTCTTGAACAGTGATTCAATTGATAATAAAGAAAAAGAATTCTTGATTCAGTTCTCTAACTTAATGATAGAAAAAAGGATTGATCAAATTCTATTGAGTCTGACTCATAGTGATCATTTATCAAAGAATGACTCTGGTTATCAAATGATTGAACAACCAGAAGTAATATACTTACGATACTTAGTTGACATTCATAAAAAATATCTAATGAATTATGAGTTCAATACATCTTATTTAGCAGAAAGATAG ATGAGACATCTAAGTCATATAAATAAAGAGATATGTTCATTGATAAGAAAAAATATGACCGGTGATTGGATTGATGAGAAAATCCAATCCTGGGTCTTGAACAGTGATTCAATTGATAATAAAGAAAAAGAATTCTTGATTCAGTTCTCTAACTTAATGATAGAAAAAAGGATTGATCAAATTCTATTGAGTCTGACTCATAGTGATCATTTATCAAAGAATGACTCTGGTTATCAAATGATTGAACAACCAGAAGTAATATACTTACGATACTTAGTTGACATTCATAAAAAATATCTAATGAATTATGAGTTCAATACATCTTATTTAGCAGAAAGATAG MRHLSHINKEICSLIRKNMTGDWIDEKIQSWVLNSDSIDNKEKEFLIQFSNLMIEKRIDQILLSLTHSDHLSKNDSGYQMIEQPEVIYLRYLVDIHKKYLMNYEFNTSYLAER Homology
BLAST of Cmc02g0044071 vs. NCBI nr
Match: ASY96395.1 (Ycf2 [Cucumis melo subsp. agrestis] >ASY96401.1 Ycf2 [Cucumis melo subsp. agrestis]) HSP 1 Score: 198.0 bits (502), Expect = 4.4e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. NCBI nr
Match: QRW36598.1 (hypothetical chloroplast RF21 [Cucumis melo] >QRW36618.1 hypothetical chloroplast RF21 [Cucumis melo]) HSP 1 Score: 198.0 bits (502), Expect = 4.4e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. NCBI nr
Match: ASY96830.1 (Ycf2 [Cucumis melo var. momordica] >ASY97004.1 Ycf2 [Cucumis melo var. cantalupo] >ASY97352.1 Ycf2 [Cucumis melo var. flexuosus] >ASY96836.1 Ycf2 [Cucumis melo var. momordica] >ASY97010.1 Ycf2 [Cucumis melo var. cantalupo]) HSP 1 Score: 198.0 bits (502), Expect = 4.4e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. NCBI nr
Match: YP_004841827.1 (hypothetical chloroplast RF21 [Cucumis melo subsp. melo] >YP_004841847.1 hypothetical chloroplast RF21 [Cucumis melo subsp. melo] >YP_009860117.1 hypothetical chloroplast RF21 [Cucumis melo subsp. agrestis] >YP_009860137.1 hypothetical chloroplast RF21 [Cucumis melo subsp. agrestis] >ASY96656.1 Ycf2 [Cucumis melo var. conomon] >ASY96743.1 Ycf2 [Cucumis melo var. makuwa] >ASY96917.1 Ycf2 [Cucumis melo var. dudaim] >ASY97178.1 Ycf2 [Cucumis melo var. inodorus] >QJF46428.1 Ycf2 [Cucumis melo]) HSP 1 Score: 198.0 bits (502), Expect = 4.4e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. NCBI nr
Match: QJA16206.1 (Ycf2 [Siraitia grosvenorii]) HSP 1 Score: 195.3 bits (495), Expect = 2.9e-46 Identity = 96/112 (85.71%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy Swiss-Prot
Match: Q2QD30 (Protein Ycf2 OS=Cucumis sativus OX=3659 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 4.2e-48 Identity = 95/112 (84.82%), Postives = 102/112 (91.07%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy Swiss-Prot
Match: A0ZZ78 (Protein Ycf2 OS=Gossypium barbadense OX=3634 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 1.6e-47 Identity = 96/114 (84.21%), Postives = 103/114 (90.35%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy Swiss-Prot
Match: Q2L949 (Protein Ycf2 OS=Gossypium hirsutum OX=3635 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 1.6e-47 Identity = 96/114 (84.21%), Postives = 103/114 (90.35%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy Swiss-Prot
Match: A4QJF8 (Protein Ycf2 OS=Aethionema cordifolium OX=434059 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 2.1e-47 Identity = 95/114 (83.33%), Postives = 103/114 (90.35%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy Swiss-Prot
Match: P56786 (Protein Ycf2 OS=Arabidopsis thaliana OX=3702 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 2.1e-47 Identity = 95/114 (83.33%), Postives = 103/114 (90.35%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy TrEMBL
Match: A0A249RYX8 (Protein Ycf2 OS=Cucumis melo var. momordica OX=2034244 GN=ycf2 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy TrEMBL
Match: G3ETW1 (Protein Ycf2 OS=Cucumis melo subsp. melo OX=412675 GN=ycf2 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy TrEMBL
Match: A0A249RZ46 (Protein Ycf2 OS=Cucumis melo var. dudaim OX=2034236 GN=ycf2 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy TrEMBL
Match: A0A1S4EU72 (Protein Ycf2 OS=Cucumis melo OX=3656 GN=ycf2 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. ExPASy TrEMBL
Match: A0A249RZN4 (Protein Ycf2 OS=Cucumis melo var. cantalupensis OX=3658 GN=ycf2 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 99/112 (88.39%), Postives = 103/112 (91.96%), Query Frame = 0
BLAST of Cmc02g0044071 vs. TAIR 10
Match: ATCG00860.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 189.5 bits (480), Expect = 1.5e-48 Identity = 95/114 (83.33%), Postives = 103/114 (90.35%), Query Frame = 0
BLAST of Cmc02g0044071 vs. TAIR 10
Match: ATCG01280.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 189.5 bits (480), Expect = 1.5e-48 Identity = 95/114 (83.33%), Postives = 103/114 (90.35%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|