Cmc01g0029051 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGTCTTTTCATCTTTTTTTCAATCAAAAAGTGTGAGGATCAAAGAATTTAAGATGTTAGAAGGTACAAAATCAATGGGTGCGGGAACTGCTACAATTGCTTCAACGAGAGCTATTATTAGTATTGGAAACATCTTCAGTTCTTTGATCCATTCTGTGGCCCGAAATCCATCATTGGCTAAACAATCATTTGGTTATGCAATTTTGGGCTTTGCTCTAACTGAAGCTATTGCATTGTTTGCTCTAATGATGGCCTTTTTTATCTCAAATTCGTATTTCGATCGAAAAGGTTTCAGTCTCACATCTTGA ATGGTTGTCTTTTCATCTTTTTTTCAATCAAAAAGTGTGAGGATCAAAGAATTTAAGATGTTAGAAGGTACAAAATCAATGGGTGCGGGAACTGCTACAATTGCTTCAACGAGAGCTATTATTAGTATTGGAAACATCTTCAGTTCTTTGATCCATTCTGTGGCCCGAAATCCATCATTGGCTAAACAATCATTTGGTTATGCAATTTTGGGCTTTGCTCTAACTGAAGCTATTGCATTGTTTGCTCTAATGATGGCCTTTTTTATCTCAAATTCGTATTTCGATCGAAAAGGTTTCAGTCTCACATCTTGA ATGGTTGTCTTTTCATCTTTTTTTCAATCAAAAAGTGTGAGGATCAAAGAATTTAAGATGTTAGAAGGTACAAAATCAATGGGTGCGGGAACTGCTACAATTGCTTCAACGAGAGCTATTATTAGTATTGGAAACATCTTCAGTTCTTTGATCCATTCTGTGGCCCGAAATCCATCATTGGCTAAACAATCATTTGGTTATGCAATTTTGGGCTTTGCTCTAACTGAAGCTATTGCATTGTTTGCTCTAATGATGGCCTTTTTTATCTCAAATTCGTATTTCGATCGAAAAGGTTTCAGTCTCACATCTTGA MVVFSSFFQSKSVRIKEFKMLEGTKSMGAGTATIASTRAIISIGNIFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFALMMAFFISNSYFDRKGFSLTS Homology
BLAST of Cmc01g0029051 vs. NCBI nr
Match: KAA0036914.1 (ATP synthase subunit 9 [Cucumis melo var. makuwa]) HSP 1 Score: 118.6 bits (296), Expect = 3.1e-23 Identity = 65/78 (83.33%), Postives = 69/78 (88.46%), Query Frame = 0
BLAST of Cmc01g0029051 vs. NCBI nr
Match: YP_009913645.1 (ATPase subunit 9 [Luffa acutangula] >QLM02675.1 ATPase subunit 9 [Luffa acutangula]) HSP 1 Score: 116.3 bits (290), Expect = 1.5e-22 Identity = 66/83 (79.52%), Postives = 71/83 (85.54%), Query Frame = 0
BLAST of Cmc01g0029051 vs. NCBI nr
Match: XP_015947650.1 (uncharacterized protein LOC107472662 [Arachis duranensis] >QHN82238.1 ATP synthase subunit 9 [Arachis hypogaea]) HSP 1 Score: 115.5 bits (288), Expect = 2.6e-22 Identity = 62/76 (81.58%), Postives = 68/76 (89.47%), Query Frame = 0
BLAST of Cmc01g0029051 vs. NCBI nr
Match: YP_009704554.1 (ATP synthase subunit 9 [Spondias mombin] >YP_009704622.1 ATP synthase subunit 9 [Spondias tuberosa] >QEP09120.1 ATP synthase subunit 9 [Spondias mombin] >QEP09152.1 ATP synthase subunit 9 [Spondias tuberosa]) HSP 1 Score: 114.4 bits (285), Expect = 5.9e-22 Identity = 65/84 (77.38%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of Cmc01g0029051 vs. NCBI nr
Match: YP_009519759.1 (ATPase subunit 9 [Nepenthes ventricosa x Nepenthes alata] >AYC21390.1 ATPase subunit 9 [Nepenthes ventricosa x Nepenthes alata]) HSP 1 Score: 114.4 bits (285), Expect = 5.9e-22 Identity = 62/78 (79.49%), Postives = 67/78 (85.90%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy Swiss-Prot
Match: Q37550 (ATP synthase subunit 9, mitochondrial OS=Malus domestica OX=3750 GN=ATP9 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 4.2e-23 Identity = 60/74 (81.08%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy Swiss-Prot
Match: P14571 (ATP synthase subunit 9, mitochondrial OS=Beta vulgaris OX=161934 GN=ATP9 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.5e-23 Identity = 61/81 (75.31%), Postives = 67/81 (82.72%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy Swiss-Prot
Match: P60113 (ATP synthase subunit 9, mitochondrial OS=Brassica napus OX=3708 GN=ATP9 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.5e-23 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy Swiss-Prot
Match: P69420 (ATP synthase subunit 9, mitochondrial OS=Pisum sativum OX=3888 GN=ATP9 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.5e-23 Identity = 59/70 (84.29%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy Swiss-Prot
Match: P69421 (ATP synthase subunit 9, mitochondrial OS=Glycine max OX=3847 GN=ATP9 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.5e-23 Identity = 59/70 (84.29%), Postives = 62/70 (88.57%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy TrEMBL
Match: A0A5A7T080 (ATP synthase subunit 9 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold9475G00040 PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 1.5e-23 Identity = 65/78 (83.33%), Postives = 69/78 (88.46%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy TrEMBL
Match: A0A7D6ISQ0 (ATP synthase subunit 9, mitochondrial OS=Luffa acutangula OX=56866 GN=atp9 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 7.5e-23 Identity = 66/83 (79.52%), Postives = 71/83 (85.54%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy TrEMBL
Match: A0A6P4C8G5 (uncharacterized protein LOC107472662 OS=Arachis duranensis OX=130453 GN=LOC107472662 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.3e-22 Identity = 62/76 (81.58%), Postives = 68/76 (89.47%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy TrEMBL
Match: A0A5C2FTY7 (ATP synthase subunit 9, mitochondrial OS=Spondias mombin OX=80338 GN=atp9 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 2.8e-22 Identity = 65/84 (77.38%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of Cmc01g0029051 vs. ExPASy TrEMBL
Match: A0A5C2FV42 (ATP synthase subunit 9, mitochondrial OS=Spondias tuberosa OX=991123 GN=atp9 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 2.8e-22 Identity = 65/84 (77.38%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of Cmc01g0029051 vs. TAIR 10
Match: AT2G07671.1 (ATP synthase subunit C family protein ) HSP 1 Score: 108.6 bits (270), Expect = 3.0e-24 Identity = 60/71 (84.51%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of Cmc01g0029051 vs. TAIR 10
Match: ATMG01080.1 (mitochondrial F0-ATPase subunit 9 ) HSP 1 Score: 108.6 bits (270), Expect = 3.0e-24 Identity = 60/71 (84.51%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of Cmc01g0029051 vs. TAIR 10
Match: ATMG00040.1 (ATP synthase subunit C family protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|