
CmaCh11G012170 (gene) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAACTATTCGTTTTGAACAACAAAAAGTGATTAATCAAGTACGACAACAGGTTTTCCAACAAGCCTTACAAGGAGCTCTAGGAACTCTGAATAGTTGTTTGAACGAGTTACATTTACGTACCATCAGTGCTAATATTGTCATTTCAAGCAAATGAAATTAGTAATATTATCCGTGAACGTATTGAGCAATATAATAGAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTAGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTACTATAGGCATAGCTCTAAATTGA ATGAAACTATTCGTTTTGAACAACAAAAATAATATTATCCGTGAACGTATTGAGCAATATAATAGAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTAGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTACTATAGGCATAGCTCTAAATTGA ATGAAACTATTCGTTTTGAACAACAAAAATAATATTATCCGTGAACGTATTGAGCAATATAATAGAGAAGTCAAAATTGTAAATACCGGTATTGTACTTCAAGTAGGCGACGACATTGCTAGTATTTATGGTCTTGATGAAGTAATGGCAGGTTCATTAGTCGAATTTGAAGAGGGTACTATAGGCATAGCTCTAAATTGA MKLFVLNNKNNIIRERIEQYNREVKIVNTGIVLQVGDDIASIYGLDEVMAGSLVEFEEGTIGIALN Homology
BLAST of CmaCh11G012170 vs. ExPASy Swiss-Prot
Match: A4QJA0 (ATP synthase subunit alpha, chloroplastic OS=Aethionema cordifolium OX=434059 GN=atpA PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.7e-21 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy Swiss-Prot
Match: A4QJI4 (ATP synthase subunit alpha, chloroplastic OS=Aethionema grandiflorum OX=72657 GN=atpA PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.7e-21 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy Swiss-Prot
Match: Q49L13 (ATP synthase subunit alpha, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=atpA PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.7e-21 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy Swiss-Prot
Match: B1NWD5 (ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta OX=3983 GN=atpA PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.7e-21 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy Swiss-Prot
Match: B0Z4N2 (ATP synthase subunit alpha, chloroplastic OS=Oenothera argillicola OX=3940 GN=atpA PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.7e-21 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy TrEMBL
Match: A0A0S2IG79 (ATP synthase subunit alpha OS=Cucurbita moschata OX=3662 GN=atpA PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.2e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy TrEMBL
Match: A0A0S2IE22 (ATP synthase subunit alpha OS=Cucurbita argyrosperma OX=34294 GN=atpA PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.2e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy TrEMBL
Match: A0A0S2IHI4 (ATP synthase subunit alpha OS=Cucurbita pepo var. texana OX=37651 GN=atpA PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.2e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy TrEMBL
Match: A0A0S2IH79 (ATP synthase subunit alpha OS=Cucurbita pepo subsp. fraterna OX=37649 GN=atpA PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.2e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. ExPASy TrEMBL
Match: A0A0S2IEP2 (ATP synthase subunit alpha OS=Cucurbita argyrosperma var. palmeri OX=1094860 GN=atpA PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.2e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. NCBI nr
Match: YP_009505065.1 (ATP synthase CF1 alpha subunit [Cucurbita pepo] >ALO21744.1 AtpA [Cucurbita argyrosperma] >ALO21775.1 AtpA [Cucurbita argyrosperma var. palmeri] >ALO21877.1 AtpA [Cucurbita argyrosperma subsp. sororia] >ALO22589.1 AtpA [Cucurbita pepo subsp. fraterna] >ALO22636.1 AtpA [Cucurbita pepo subsp. ovifera] >ALO22733.1 AtpA [Cucurbita pepo var. ozarkana] >ALO22734.1 AtpA [Cucurbita pepo subsp. pepo] >ALO22815.1 AtpA [Cucurbita pepo var. texana]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. NCBI nr
Match: ALO21904.1 (AtpA [Cucurbita cordata] >ALO21987.1 AtpA [Cucurbita digitata]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. NCBI nr
Match: ALO22114.1 (AtpA [Cucurbita ficifolia] >ALO22152.1 AtpA [Cucurbita foetidissima] >ALO22919.1 AtpA [Cucurbita pedatifolia] >QWV60825.1 ATP synthase CF1 alpha subunit [Cucurbita ficifolia] >QZL38756.1 ATP synthase CF1 alpha subunit [Cucurbita ficifolia]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. NCBI nr
Match: YP_009447520.1 (ATP synthase CF1 alpha subunit [Cucurbita moschata] >ALO22375.1 AtpA [Cucurbita moschata] >ATY69952.1 ATP synthase CF1 alpha subunit [Cucurbita moschata]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 54/60 (90.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of CmaCh11G012170 vs. NCBI nr
Match: KAF2300939.1 (hypothetical protein GH714_018446 [Hevea brasiliensis]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 53/57 (92.98%), Postives = 54/57 (94.74%), Query Frame = 0
BLAST of CmaCh11G012170 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 98.6 bits (244), Expect = 2.0e-21 Identity = 51/57 (89.47%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of CmaCh11G012170 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 48.9 bits (115), Expect = 1.8e-06 Identity = 23/56 (41.07%), Postives = 33/56 (58.93%), Query Frame = 0
BLAST of CmaCh11G012170 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 48.9 bits (115), Expect = 1.8e-06 Identity = 23/56 (41.07%), Postives = 33/56 (58.93%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|