CmUC11G219250 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCCAACATCGGCTATGGATCACGCCCATCATCATAAGGGCATCTCGATATGGGGTTGGATCATCGGCCCTGGTGATGGCTCCCCTTACTAGTAAAGGAAACAGGAATCGCGGAATTAGACCTGCTATTAACGTCGGCTTATCTGTCAGTCGCGTCGGGTCTGCCGCTCAGTTGAAAGCTATGAATGAGGATTCCTTCAATATCTTTCTTTATTTAAATTTTTAA ATGTTCCAACATCGGCTATGGATCACGCCCATCATCATAAGGGCATCTCGATATGGGGTTGGATCATCGGCCCTGGTGATGGCTCCCCTTACTAGTAAAGGAAACAGGAATCGCGGAATTAGACCTGCTATTAACGTCGGCTTATCTGTCAGTCGCGTCGGGTCTGCCGCTCAGTTGAAAGCTATGAATGAGGATTCCTTCAATATCTTTCTTTATTTAAATTTTTAA ATGTTCCAACATCGGCTATGGATCACGCCCATCATCATAAGGGCATCTCGATATGGGGTTGGATCATCGGCCCTGGTGATGGCTCCCCTTACTAGTAAAGGAAACAGGAATCGCGGAATTAGACCTGCTATTAACGTCGGCTTATCTGTCAGTCGCGTCGGGTCTGCCGCTCAGTTGAAAGCTATGAATGAGGATTCCTTCAATATCTTTCTTTATTTAAATTTTTAA MFQHRLWITPIIIRASRYGVGSSALVMAPLTSKGNRNRGIRPAINVGLSVSRVGSAAQLKAMNEDSFNIFLYLNF Homology
BLAST of CmUC11G219250 vs. NCBI nr
Match: GFF64897.1 (hypothetical protein IFM60648_01424 [Aspergillus lentulus] >GFF79568.1 hypothetical protein IFM62136_10097 [Aspergillus lentulus] >GFF96619.1 hypothetical protein IFM47457_10971 [Aspergillus lentulus]) HSP 1 Score: 53.9 bits (128), Expect = 6.9e-04 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 0
BLAST of CmUC11G219250 vs. NCBI nr
Match: GCB25816.1 (ATP synthase subunit alpha, mitochondrial [Aspergillus awamori]) HSP 1 Score: 53.9 bits (128), Expect = 6.9e-04 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. NCBI nr
Match: XP_035352552.1 (ATP synthase F1, alpha subunit [Aspergillus tubingensis] >GAQ47664.1 hypothetical protein AN5084.2 [Aspergillus niger] >GFN11748.1 ATP synthase F1, alpha subunit [Aspergillus tubingensis]) HSP 1 Score: 53.9 bits (128), Expect = 6.9e-04 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. NCBI nr
Match: OJI80382.1 (hypothetical protein ASPTUDRAFT_59113 [Aspergillus tubingensis CBS 134.48]) HSP 1 Score: 53.9 bits (128), Expect = 6.9e-04 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. NCBI nr
Match: RDK41069.1 (ATP synthase F1, alpha subunit [Aspergillus phoenicis ATCC 13157]) HSP 1 Score: 53.9 bits (128), Expect = 6.9e-04 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy Swiss-Prot
Match: P37211 (ATP synthase subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=atp-1 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.6e-06 Identity = 25/36 (69.44%), Postives = 32/36 (88.89%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy Swiss-Prot
Match: P92549 (ATP synthase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ATPA PE=1 SV=2) HSP 1 Score: 50.4 bits (119), Expect = 1.0e-05 Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy Swiss-Prot
Match: Q06735 (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.0e-05 Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy Swiss-Prot
Match: P68542 (ATP synthase subunit alpha, mitochondrial OS=Brassica campestris OX=3711 GN=ATPA PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.0e-05 Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy Swiss-Prot
Match: P22201 (ATP synthase subunit alpha, mitochondrial OS=Brassica napus OX=3708 GN=ATPA PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.0e-05 Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy TrEMBL
Match: A0A370PFU9 (ATP synthase subunit alpha OS=Aspergillus phoenicis ATCC 13157 OX=1353007 GN=M752DRAFT_302627 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 3.3e-04 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy TrEMBL
Match: A0A100IUM3 (ATP synthase subunit alpha OS=Aspergillus niger OX=5061 GN=ABL_10325 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 3.3e-04 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy TrEMBL
Match: Q5B2Z6 (Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN5084.2 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 3.3e-04 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy TrEMBL
Match: C8V7Z2 (ATP synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10626 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 3.3e-04 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. ExPASy TrEMBL
Match: A0A401L2U7 (ATP synthase subunit alpha OS=Aspergillus awamori OX=105351 GN=AAWM_08701 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 3.3e-04 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0
BLAST of CmUC11G219250 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 50.4 bits (119), Expect = 7.1e-07 Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 0
BLAST of CmUC11G219250 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 50.4 bits (119), Expect = 7.1e-07 Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 0
BLAST of CmUC11G219250 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 23/28 (82.14%), Postives = 26/28 (92.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|