
CmUC05G085240 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAACACATGCAAAGGTATAAATGGCTATCTTGAATTAATGCGACGTCGTTTTAGGGAAAAAAAAAAAAACTATTTTCTTTATTGTTGATTTTTCTTTTCCCTTTTATTTTGGATGTGTGACACACAGGAAAGAGCTCATGGCCCGAGCTTGTTAATGCTCCAGGAGAAATTGCACAGAAAATTATAGAGAAGCAAAATAGTTTTGTTAGAGCCATAATAATTGAAGAAGGATCATCTGTCACCACCAACTTCAGGTGTGATCGAGTTTTTGTTTTTGTCAACAAGAAGACTGATACCGTTACCAGGACCCCTCGCATAGGCTAA ATGGCAAACACATGCAAAGGAAAGAGCTCATGGCCCGAGCTTGTTAATGCTCCAGGAGAAATTGCACAGAAAATTATAGAGAAGCAAAATAGTTTTGTTAGAGCCATAATAATTGAAGAAGGATCATCTGTCACCACCAACTTCAGGTGTGATCGAGTTTTTGTTTTTGTCAACAAGAAGACTGATACCGTTACCAGGACCCCTCGCATAGGCTAA ATGGCAAACACATGCAAAGGAAAGAGCTCATGGCCCGAGCTTGTTAATGCTCCAGGAGAAATTGCACAGAAAATTATAGAGAAGCAAAATAGTTTTGTTAGAGCCATAATAATTGAAGAAGGATCATCTGTCACCACCAACTTCAGGTGTGATCGAGTTTTTGTTTTTGTCAACAAGAAGACTGATACCGTTACCAGGACCCCTCGCATAGGCTAA MANTCKGKSSWPELVNAPGEIAQKIIEKQNSFVRAIIIEEGSSVTTNFRCDRVFVFVNKKTDTVTRTPRIG Homology
BLAST of CmUC05G085240 vs. NCBI nr
Match: KAA0049293.1 (inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa] >TYK17265.1 inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa]) HSP 1 Score: 118.6 bits (296), Expect = 2.2e-23 Identity = 56/71 (78.87%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC05G085240 vs. NCBI nr
Match: KGN56903.1 (hypothetical protein Csa_010041 [Cucumis sativus]) HSP 1 Score: 115.9 bits (289), Expect = 1.4e-22 Identity = 54/71 (76.06%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC05G085240 vs. NCBI nr
Match: XP_004134090.1 (glu S.griseus protease inhibitor [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 8.8e-17 Identity = 46/71 (64.79%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of CmUC05G085240 vs. NCBI nr
Match: KAE8650342.1 (hypothetical protein Csa_009611 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 8.8e-17 Identity = 46/71 (64.79%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of CmUC05G085240 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 94.4 bits (233), Expect = 4.3e-16 Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 5.5e-14 Identity = 37/69 (53.62%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy Swiss-Prot
Match: P24076 (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.7e-12 Identity = 34/67 (50.75%), Postives = 47/67 (70.15%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.4e-11 Identity = 32/66 (48.48%), Postives = 45/66 (68.18%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy Swiss-Prot
Match: P80211 (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.2e-10 Identity = 35/69 (50.72%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 62.8 bits (151), Expect = 1.8e-09 Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy TrEMBL
Match: A0A5D3D0M4 (Inhibitor of trypsin and hageman factor-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001180 PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 1.0e-23 Identity = 56/71 (78.87%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy TrEMBL
Match: A0A0A0L593 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142950 PE=3 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 6.7e-23 Identity = 54/71 (76.06%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy TrEMBL
Match: A0A0A0L795 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 4.2e-17 Identity = 46/71 (64.79%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy TrEMBL
Match: A0A1S4DTF7 (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 2.1e-16 Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of CmUC05G085240 vs. ExPASy TrEMBL
Match: A0A0A0L4J0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 4.7e-16 Identity = 44/71 (61.97%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of CmUC05G085240 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 65.9 bits (159), Expect = 1.5e-11 Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of CmUC05G085240 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-10 Identity = 34/73 (46.58%), Postives = 50/73 (68.49%), Query Frame = 0
BLAST of CmUC05G085240 vs. TAIR 10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 54.7 bits (130), Expect = 3.6e-08 Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of CmUC05G085240 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 50.4 bits (119), Expect = 6.7e-07 Identity = 24/65 (36.92%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of CmUC05G085240 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 50.4 bits (119), Expect = 6.7e-07 Identity = 24/65 (36.92%), Postives = 40/65 (61.54%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|