CmUC03G059730 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATATAAGAAGTTCAAATACAGCCCCAGTTCACCGATTAGTGTTTCTTCATAGAGGCAGTAAGGACCAGAATCCATCATGGTGAACATTCCCAAGACGAAGAAGACTTACTGCAAAAGCAAGGAGTGCAGAAAGCATACCTTGCACAAGGTTACGTAATACAAAAAGGGTAAGGACAGTCTTGCTGCTCAAGGAAAGCGTCATTATGATGGTAAACAATCAGGATATGGAGGACAGACCAAGCCTCTCTTTCATAAGGCGGCCAAAACTACAAAGAAGATTGTGCTAAGGTTGCAATGCCAGGGTTGCAAGCATGTCTCACAGCATCCCATTAAGAGATACAAGCATTTTGAGATTGGTGAGGACAACAAGGCAAAGGGAACTTCTCCTTTTTAG ATGAATATAAGAAGTTCAAATACAGCCCCAGTTCACCGATTAGTGTTTCTTCATAGAGGCAGTAAGGACCAGAATCCATCATGTCTTGCTGCTCAAGGAAAGCGTCATTATGATGGTAAACAATCAGGATATGGAGGACAGACCAAGCCTCTCTTTCATAAGGCGGCCAAAACTACAAAGAAGATTGTGCTAAGGTTGCAATGCCAGGGTTGCAAGCATGTCTCACAGCATCCCATTAAGAGATACAAGCATTTTGAGATTGGTGAGGACAACAAGGCAAAGGGAACTTCTCCTTTTTAG ATGAATATAAGAAGTTCAAATACAGCCCCAGTTCACCGATTAGTGTTTCTTCATAGAGGCAGTAAGGACCAGAATCCATCATGTCTTGCTGCTCAAGGAAAGCGTCATTATGATGGTAAACAATCAGGATATGGAGGACAGACCAAGCCTCTCTTTCATAAGGCGGCCAAAACTACAAAGAAGATTGTGCTAAGGTTGCAATGCCAGGGTTGCAAGCATGTCTCACAGCATCCCATTAAGAGATACAAGCATTTTGAGATTGGTGAGGACAACAAGGCAAAGGGAACTTCTCCTTTTTAG MNIRSSNTAPVHRLVFLHRGSKDQNPSCLAAQGKRHYDGKQSGYGGQTKPLFHKAAKTTKKIVLRLQCQGCKHVSQHPIKRYKHFEIGEDNKAKGTSPF Homology
BLAST of CmUC03G059730 vs. NCBI nr
Match: XP_021655322.1 (60S ribosomal protein L44-like [Hevea brasiliensis] >KAF2317408.1 hypothetical protein GH714_021848 [Hevea brasiliensis]) HSP 1 Score: 132.9 bits (333), Expect = 1.5e-27 Identity = 62/71 (87.32%), Postives = 64/71 (90.14%), Query Frame = 0
BLAST of CmUC03G059730 vs. NCBI nr
Match: KAG5576874.1 (hypothetical protein H5410_057008 [Solanum commersonii]) HSP 1 Score: 131.3 bits (329), Expect = 4.5e-27 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. NCBI nr
Match: XP_022037485.1 (60S ribosomal protein L44 [Helianthus annuus] >KAF5813184.1 putative ribosomal protein L44e [Helianthus annuus]) HSP 1 Score: 130.6 bits (327), Expect = 7.6e-27 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. NCBI nr
Match: RVX02874.1 (60S ribosomal protein L44 [Vitis vinifera]) HSP 1 Score: 129.8 bits (325), Expect = 1.3e-26 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. NCBI nr
Match: KAF3451002.1 (hypothetical protein FNV43_RR07091 [Rhamnella rubrinervis]) HSP 1 Score: 129.8 bits (325), Expect = 1.3e-26 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy Swiss-Prot
Match: Q96499 (60S ribosomal protein L44 OS=Gossypium hirsutum OX=3635 GN=RPL44 PE=3 SV=3) HSP 1 Score: 129.8 bits (325), Expect = 1.7e-29 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy Swiss-Prot
Match: O23290 (60S ribosomal protein L36a OS=Arabidopsis thaliana OX=3702 GN=RPL36AA PE=3 SV=3) HSP 1 Score: 122.5 bits (306), Expect = 2.7e-27 Identity = 59/71 (83.10%), Postives = 60/71 (84.51%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy Swiss-Prot
Match: O59870 (60S ribosomal protein L44 OS=Phaffia rhodozyma OX=264483 GN=RPL44 PE=3 SV=3) HSP 1 Score: 100.1 bits (248), Expect = 1.4e-20 Identity = 46/67 (68.66%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy Swiss-Prot
Match: Q9UTI8 (60S ribosomal protein L42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpl42 PE=1 SV=3) HSP 1 Score: 99.4 bits (246), Expect = 2.5e-20 Identity = 48/87 (55.17%), Postives = 60/87 (68.97%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy Swiss-Prot
Match: P0CQ51 (60S ribosomal protein L44 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=RPL44 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.2e-20 Identity = 46/69 (66.67%), Postives = 54/69 (78.26%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy TrEMBL
Match: A0A6A6MY88 (Uncharacterized protein OS=Hevea brasiliensis OX=3981 GN=GH714_021848 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 7.4e-28 Identity = 62/71 (87.32%), Postives = 64/71 (90.14%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy TrEMBL
Match: A0A251UQ93 (Putative ribosomal protein L44e, Zinc-binding ribosomal protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0137471 PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 3.7e-27 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy TrEMBL
Match: Q00508 (Ribosomal protein L41 OS=Candida maltosa OX=5479 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 6.3e-27 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy TrEMBL
Match: A0A251SZA8 (Putative ribosomal protein L44e, Zinc-binding ribosomal protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr03g0066261 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 6.3e-27 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. ExPASy TrEMBL
Match: A0A059AD57 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_G02575 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 6.3e-27 Identity = 62/71 (87.32%), Postives = 63/71 (88.73%), Query Frame = 0
BLAST of CmUC03G059730 vs. TAIR 10
Match: AT3G23390.1 (Zinc-binding ribosomal protein family protein ) HSP 1 Score: 122.5 bits (306), Expect = 1.9e-28 Identity = 59/71 (83.10%), Postives = 60/71 (84.51%), Query Frame = 0
BLAST of CmUC03G059730 vs. TAIR 10
Match: AT4G14320.1 (Zinc-binding ribosomal protein family protein ) HSP 1 Score: 122.5 bits (306), Expect = 1.9e-28 Identity = 59/71 (83.10%), Postives = 60/71 (84.51%), Query Frame = 0
BLAST of CmUC03G059730 vs. TAIR 10
Match: AT4G14320.2 (Zinc-binding ribosomal protein family protein ) HSP 1 Score: 107.8 bits (268), Expect = 4.9e-24 Identity = 51/59 (86.44%), Postives = 52/59 (88.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|