
CmUC02G036550 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGGTCATTATTTTTTTTCCTTGATTTTCTTTCCCAATTTGCAATGAAAACTTTTCCCAATTTCATATACCTTTTGGCAATCTCAAAACTAAAAATATAATCTCTTTAAAAAAAATTCAACAAAAATGAAGCTATCATGATTTTTTTTTTCGATAAAACTTATCCTATTTTTACAGTGCGATAGTTGGCTGTTCACGGATTAGCTGTACCTACCGTTTCTTTTTTAGGGTCAATATCAGCAATGCAATTCATCCAACGATAAACCTAATCCGAATTATAGAGCTATGACACAATCAAATCCGAACAAACAAAATGTTGAATTGAATCGTACCAGTCTTTACTGGGGGTTATTACTCATTTTTGTACTTGCTGTTTTATTTTCCAATTATTTCTTCAATTAA ATGTGGGGTCAATATCAGCAATGCAATTCATCCAACGATAAACCTAATCCGAATTATAGAGCTATGACACAATCAAATCCGAACAAACAAAATGTTGAATTGAATCGTACCAGTCTTTACTGGGGGTTATTACTCATTTTTGTACTTGCTGTTTTATTTTCCAATTATTTCTTCAATTAA ATGTGGGGTCAATATCAGCAATGCAATTCATCCAACGATAAACCTAATCCGAATTATAGAGCTATGACACAATCAAATCCGAACAAACAAAATGTTGAATTGAATCGTACCAGTCTTTACTGGGGGTTATTACTCATTTTTGTACTTGCTGTTTTATTTTCCAATTATTTCTTCAATTAA MWGQYQQCNSSNDKPNPNYRAMTQSNPNKQNVELNRTSLYWGLLLIFVLAVLFSNYFFN Homology
BLAST of CmUC02G036550 vs. NCBI nr
Match: YP_009387574.1 (photosystem II protein L [Hansenia weberbaueriana] >YP_009387659.1 photosystem II protein L [Hansenia forbesii] >YP_009387829.1 photosystem II protein L [Hansenia forrestii] >YP_010116922.1 photosystem II protein L [Haplosphaera himalayensis] >QHS71219.1 photosystem II protein L [Haplosphaera phaea] >QPG23974.1 photosystem II protein L [Hansenia oviformis] >ART32526.1 photosystem II protein L [Hansenia weberbaueriana] >ART32611.1 photosystem II protein L [Hansenia forbesii] >ART32781.1 photosystem II protein L [Hansenia forrestii]) HSP 1 Score: 117.1 bits (292), Expect = 5.2e-23 Identity = 56/58 (96.55%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. NCBI nr
Match: QKD76372.1 (photosystem II protein L [Santalum album] >BBZ90126.1 photosystem II protein L [Santalum boninense]) HSP 1 Score: 116.7 bits (291), Expect = 6.8e-23 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of CmUC02G036550 vs. NCBI nr
Match: YP_009920018.1 (photosystem II protein L [Cinnamomum longipetiolatum] >QMQ98907.1 photosystem II protein L [Cinnamomum longipetiolatum]) HSP 1 Score: 114.8 bits (286), Expect = 2.6e-22 Identity = 55/58 (94.83%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of CmUC02G036550 vs. NCBI nr
Match: YP_009860414.1 (photosystem II protein L [Litsea cubeba] >YP_009919936.1 photosystem II protein L [Cinnamomum kotoense] >YP_009920186.1 photosystem II protein L [Litsea garrettii] >QMQ98738.1 photosystem II protein L [Cinnamomum aromaticum] >QKV10051.1 photosystem II protein L [Litsea cubeba] >QMQ98822.1 photosystem II protein L [Cinnamomum kotoense] >QMQ99071.1 photosystem II protein L [Litsea garrettii]) HSP 1 Score: 114.8 bits (286), Expect = 2.6e-22 Identity = 55/58 (94.83%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of CmUC02G036550 vs. NCBI nr
Match: WP_222273419.1 (hypothetical protein, partial [Modestobacter marinus]) HSP 1 Score: 114.8 bits (286), Expect = 2.6e-22 Identity = 55/58 (94.83%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy Swiss-Prot
Match: Q7J1C4 (Photosystem II reaction center protein L OS=Acorus calamus OX=4465 GN=psbL PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.3e-13 Identity = 37/38 (97.37%), Postives = 38/38 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy Swiss-Prot
Match: Q6EYW2 (Photosystem II reaction center protein L OS=Agathis robusta OX=60854 GN=psbL PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.3e-13 Identity = 37/38 (97.37%), Postives = 38/38 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy Swiss-Prot
Match: A1EA23 (Photosystem II reaction center protein L OS=Agrostis stolonifera OX=63632 GN=psbL PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.3e-13 Identity = 37/38 (97.37%), Postives = 38/38 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy Swiss-Prot
Match: Q67HN6 (Photosystem II reaction center protein L OS=Ananas comosus OX=4615 GN=psbL PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.3e-13 Identity = 37/38 (97.37%), Postives = 38/38 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy Swiss-Prot
Match: A4QK33 (Photosystem II reaction center protein L OS=Arabis hirsuta OX=78191 GN=psbL PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.3e-13 Identity = 37/38 (97.37%), Postives = 38/38 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy TrEMBL
Match: A0A1Y0B5C9 (Photosystem II reaction center protein L OS=Hansenia forbesii OX=165499 GN=psbL PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.5e-23 Identity = 56/58 (96.55%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy TrEMBL
Match: A0A1Y0B539 (Photosystem II reaction center protein L OS=Hansenia weberbaueriana OX=54724 GN=psbL PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.5e-23 Identity = 56/58 (96.55%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy TrEMBL
Match: A0A1Y0B5U7 (Photosystem II reaction center protein L OS=Hansenia forrestii OX=1050841 GN=psbL PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.5e-23 Identity = 56/58 (96.55%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy TrEMBL
Match: A0A6C0AB03 (Photosystem II reaction center protein L OS=Haplosphaera phaea OX=239646 GN=psbL PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.5e-23 Identity = 56/58 (96.55%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. ExPASy TrEMBL
Match: A0A7S9HVQ3 (Photosystem II protein L OS=Hansenia oviformis OX=1978917 GN=psbL PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.5e-23 Identity = 56/58 (96.55%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of CmUC02G036550 vs. TAIR 10
Match: ATCG00560.1 (photosystem II reaction center protein L ) HSP 1 Score: 73.6 bits (179), Expect = 6.1e-14 Identity = 36/38 (94.74%), Postives = 38/38 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|