
Clc04G09645 (gene) Watermelon (cordophanus) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAACCTTCCTCTTCACTCATAAATCTGTCAACGAGGGCCATCCCGACAAGCTTTGCGACCAAGTTTCCGATGCTATCCTCCACACTTGTCTTGAACAAGATTCTGAGAGCAATGTCGCTTGTAAAACCTACACCAAAACCAACATGGTCATGGTGTTTGATGAGATAACAATCAAGGCTAATGTCAACTATGAGAAGGTGGTTCGAAATACTTGCAACGGAATTGGATTTGTCTCTATTGATGTCAGTCTTGATGCAGACGACTGCAACATGAATATTGAACAACAACGAATCCCAGAGCCGACACACTTGACCAAGAAACCTGAGGATATTGGAGCTGGTGATCTAGGCCACATGAGTTCTCACCCATGTCCTTGCTACAAAACTTGGTGCTAA ATGGAAACCTTCCTCTTCACTCATAAATCTGTCAACGAGGGCCATCCCGACAAGCTTTGCGACCAAGTTTCCGATGCTATCCTCCACACTTGTCTTGAACAAGATTCTGAGAGCAATGTCGCTTGTAAAACCTACACCAAAACCAACATGGTCATGGTGTTTGATGAGATAACAATCAAGGCTAATGTCAACTATGAGAAGGTGGTTCGAAATACTTGCAACGGAATTGGATTTGTCTCTATTGATGTCAGTCTTGATGCAGACGACTGCAACATGAATATTGAACAACAACGAATCCCAGAGCCGACACACTTGACCAAGAAACCTGAGGATATTGGAGCTGGTGATCTAGGCCACATGAGTTCTCACCCATGTCCTTGCTACAAAACTTGGTGCTAA ATGGAAACCTTCCTCTTCACTCATAAATCTGTCAACGAGGGCCATCCCGACAAGCTTTGCGACCAAGTTTCCGATGCTATCCTCCACACTTGTCTTGAACAAGATTCTGAGAGCAATGTCGCTTGTAAAACCTACACCAAAACCAACATGGTCATGGTGTTTGATGAGATAACAATCAAGGCTAATGTCAACTATGAGAAGGTGGTTCGAAATACTTGCAACGGAATTGGATTTGTCTCTATTGATGTCAGTCTTGATGCAGACGACTGCAACATGAATATTGAACAACAACGAATCCCAGAGCCGACACACTTGACCAAGAAACCTGAGGATATTGGAGCTGGTGATCTAGGCCACATGAGTTCTCACCCATGTCCTTGCTACAAAACTTGGTGCTAA METFLFTHKSVNEGHPDKLCDQVSDAILHTCLEQDSESNVACKTYTKTNMVMVFDEITIKANVNYEKVVRNTCNGIGFVSIDVSLDADDCNMNIEQQRIPEPTHLTKKPEDIGAGDLGHMSSHPCPCYKTWC Homology
BLAST of Clc04G09645 vs. NCBI nr
Match: RYR77347.1 (hypothetical protein Ahy_A01g001774 isoform C [Arachis hypogaea]) HSP 1 Score: 184.1 bits (466), Expect = 7.7e-43 Identity = 93/127 (73.23%), Postives = 104/127 (81.89%), Query Frame = 0
BLAST of Clc04G09645 vs. NCBI nr
Match: QHO50060.1 (S-adenosylmethionine synthase [Arachis hypogaea]) HSP 1 Score: 184.1 bits (466), Expect = 7.7e-43 Identity = 93/127 (73.23%), Postives = 104/127 (81.89%), Query Frame = 0
BLAST of Clc04G09645 vs. NCBI nr
Match: QHO39172.1 (S-adenosylmethionine synthase [Arachis hypogaea]) HSP 1 Score: 184.1 bits (466), Expect = 7.7e-43 Identity = 94/127 (74.02%), Postives = 103/127 (81.10%), Query Frame = 0
BLAST of Clc04G09645 vs. NCBI nr
Match: RYR77345.1 (hypothetical protein Ahy_A01g001774 isoform A [Arachis hypogaea]) HSP 1 Score: 184.1 bits (466), Expect = 7.7e-43 Identity = 93/127 (73.23%), Postives = 104/127 (81.89%), Query Frame = 0
BLAST of Clc04G09645 vs. NCBI nr
Match: XP_025604425.1 (S-adenosylmethionine synthase 3-like [Arachis hypogaea]) HSP 1 Score: 184.1 bits (466), Expect = 7.7e-43 Identity = 93/127 (73.23%), Postives = 104/127 (81.89%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy Swiss-Prot
Match: A7PQS0 (S-adenosylmethionine synthase 1 OS=Vitis vinifera OX=29760 GN=METK1 PE=3 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 1.1e-44 Identity = 93/127 (73.23%), Postives = 102/127 (80.31%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy Swiss-Prot
Match: A9NUH8 (S-adenosylmethionine synthase 1 OS=Picea sitchensis OX=3332 GN=METK1 PE=2 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.9e-44 Identity = 90/127 (70.87%), Postives = 103/127 (81.10%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy Swiss-Prot
Match: P43282 (S-adenosylmethionine synthase 3 OS=Solanum lycopersicum OX=4081 GN=SAM3 PE=2 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.9e-44 Identity = 93/127 (73.23%), Postives = 102/127 (80.31%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy Swiss-Prot
Match: Q96553 (S-adenosylmethionine synthase 3 OS=Catharanthus roseus OX=4058 GN=SAMS3 PE=1 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 2.5e-44 Identity = 93/127 (73.23%), Postives = 101/127 (79.53%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy Swiss-Prot
Match: Q9M7K8 (S-adenosylmethionine synthase 1 OS=Nicotiana tabacum OX=4097 GN=SAMS1 PE=2 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 5.6e-44 Identity = 92/127 (72.44%), Postives = 101/127 (79.53%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy TrEMBL
Match: A0A445EPP0 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A01g001774 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 3.8e-43 Identity = 93/127 (73.23%), Postives = 104/127 (81.89%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy TrEMBL
Match: A0A445EPF3 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A01g001774 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 3.8e-43 Identity = 93/127 (73.23%), Postives = 104/127 (81.89%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy TrEMBL
Match: A0A445EPE5 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A01g001774 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 3.8e-43 Identity = 93/127 (73.23%), Postives = 104/127 (81.89%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy TrEMBL
Match: A0A1S3TR49 (S-adenosylmethionine synthase OS=Vigna radiata var. radiata OX=3916 GN=LOC106757909 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 8.4e-43 Identity = 94/127 (74.02%), Postives = 103/127 (81.10%), Query Frame = 0
BLAST of Clc04G09645 vs. ExPASy TrEMBL
Match: I1L8X2 (S-adenosylmethionine synthase OS=Glycine max OX=3847 GN=100816602 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 8.4e-43 Identity = 94/127 (74.02%), Postives = 102/127 (80.31%), Query Frame = 0
BLAST of Clc04G09645 vs. TAIR 10
Match: AT2G36880.1 (methionine adenosyltransferase 3 ) HSP 1 Score: 176.8 bits (447), Expect = 1.2e-44 Identity = 91/127 (71.65%), Postives = 100/127 (78.74%), Query Frame = 0
BLAST of Clc04G09645 vs. TAIR 10
Match: AT2G36880.2 (methionine adenosyltransferase 3 ) HSP 1 Score: 176.8 bits (447), Expect = 1.2e-44 Identity = 91/127 (71.65%), Postives = 100/127 (78.74%), Query Frame = 0
BLAST of Clc04G09645 vs. TAIR 10
Match: AT3G17390.1 (S-adenosylmethionine synthetase family protein ) HSP 1 Score: 174.9 bits (442), Expect = 4.4e-44 Identity = 89/127 (70.08%), Postives = 101/127 (79.53%), Query Frame = 0
BLAST of Clc04G09645 vs. TAIR 10
Match: AT4G01850.1 (S-adenosylmethionine synthetase 2 ) HSP 1 Score: 172.2 bits (435), Expect = 2.8e-43 Identity = 86/127 (67.72%), Postives = 99/127 (77.95%), Query Frame = 0
BLAST of Clc04G09645 vs. TAIR 10
Match: AT4G01850.2 (S-adenosylmethionine synthetase 2 ) HSP 1 Score: 172.2 bits (435), Expect = 2.8e-43 Identity = 86/127 (67.72%), Postives = 99/127 (77.95%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (cordophanus) v2
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|