Clc01G13600 (gene) Watermelon (cordophanus) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAGATCCAATACTCTGAGAAATACTTTGATGATATCTATGAGTACAGGTCAGTAATTTCTCTTCCTCCTCTGTTTTTCGATTCAGGATGATTTTATGCTCTGGATTTGTTCATCGGCATGGTTTGATTCTCATGTTTGTTGTAGGCATGTAGTGCTTCCTCCTGAAGTCGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAGTAAGTATTTCACGATTCTCCTCTATATCATAATTTCTTGTGTTGAATCCTGTTCCGGTGATCAGTAGTGAAATGAAATAGATATCTCTCATAATCATCGGTTGCTTTTCCTCTGATTGATAAGTGTGATAGAATCTGAATACTTGAGATCTGTGTAATTTGATTATGTGATGATGGACAGAATGAATGGCGAGCCATTGGTGTTCAGCAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCGCACATAATGCTGTTCAGAAGACCACTCAATTATCAACAGCAGCAAGAGAATCAAGCACAGCAGCAGATTATGGCCAAGTGA ATGGGTCAGATCCAATACTCTGAGAAATACTTTGATGATATCTATGAGTACAGGCATGTAGTGCTTCCTCCTGAAGTCGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGCGAGCCATTGGTGTTCAGCAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCGCACATAATGCTGTTCAGAAGACCACTCAATTATCAACAGCAGCAAGAGAATCAAGCACAGCAGCAGATTATGGCCAAGTGA ATGGGTCAGATCCAATACTCTGAGAAATACTTTGATGATATCTATGAGTACAGGCATGTAGTGCTTCCTCCTGAAGTCGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGCGAGCCATTGGTGTTCAGCAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCGCACATAATGCTGTTCAGAAGACCACTCAATTATCAACAGCAGCAAGAGAATCAAGCACAGCAGCAGATTATGGCCAAGTGA MGQIQYSEKYFDDIYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQQIMAK Homology
BLAST of Clc01G13600 vs. NCBI nr
Match: XP_038894383.1 (cyclin-dependent kinases regulatory subunit 1 [Benincasa hispida]) HSP 1 Score: 183.0 bits (463), Expect = 1.2e-42 Identity = 87/88 (98.86%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Clc01G13600 vs. NCBI nr
Match: XP_010267303.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] >XP_010267305.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] >XP_010267306.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera]) HSP 1 Score: 179.9 bits (455), Expect = 9.7e-42 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. NCBI nr
Match: XP_011654109.1 (cyclin-dependent kinases regulatory subunit 1 [Cucumis sativus] >XP_016903015.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 isoform X2 [Cucumis melo] >KGN64861.1 hypothetical protein Csa_022815 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 9.7e-42 Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. NCBI nr
Match: XP_042489972.1 (cyclin-dependent kinases regulatory subunit 1-like [Macadamia integrifolia]) HSP 1 Score: 179.5 bits (454), Expect = 1.3e-41 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. NCBI nr
Match: KAF3455154.1 (hypothetical protein FNV43_RR05602 [Rhamnella rubrinervis]) HSP 1 Score: 178.7 bits (452), Expect = 2.2e-41 Identity = 85/86 (98.84%), Postives = 85/86 (98.84%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy Swiss-Prot
Match: O23249 (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CKS1 PE=1 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.7e-42 Identity = 79/86 (91.86%), Postives = 83/86 (96.51%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy Swiss-Prot
Match: A2XCH8 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica OX=39946 GN=CKS1 PE=2 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 7.3e-40 Identity = 77/81 (95.06%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy Swiss-Prot
Match: Q6PS57 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CKS1 PE=2 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 7.3e-40 Identity = 77/81 (95.06%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy Swiss-Prot
Match: Q9SJJ5 (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CKS2 PE=1 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.2e-37 Identity = 71/80 (88.75%), Postives = 77/80 (96.25%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy Swiss-Prot
Match: P55933 (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum OX=5791 PE=1 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 3.7e-28 Identity = 53/66 (80.30%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy TrEMBL
Match: A0A1U8AJ97 (Cyclin-dependent kinases regulatory subunit OS=Nelumbo nucifera OX=4432 GN=LOC104604585 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 4.7e-42 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy TrEMBL
Match: A0A0A0LY04 (Cyclin-dependent kinases regulatory subunit OS=Cucumis sativus OX=3659 GN=Csa_1G132710 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 4.7e-42 Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy TrEMBL
Match: A0A1S4E4W6 (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo OX=3656 GN=LOC103500769 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 4.7e-42 Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy TrEMBL
Match: A0A6J1I3M7 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita maxima OX=3661 GN=LOC111469347 PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 1.1e-41 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. ExPASy TrEMBL
Match: A0A6J1HM34 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita moschata OX=3662 GN=LOC111464859 PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 1.1e-41 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Clc01G13600 vs. TAIR 10
Match: AT2G27960.1 (cyclin-dependent kinase-subunit 1 ) HSP 1 Score: 170.6 bits (431), Expect = 5.5e-43 Identity = 79/86 (91.86%), Postives = 83/86 (96.51%), Query Frame = 0
BLAST of Clc01G13600 vs. TAIR 10
Match: AT2G27970.1 (CDK-subunit 2 ) HSP 1 Score: 156.8 bits (395), Expect = 8.2e-39 Identity = 71/80 (88.75%), Postives = 77/80 (96.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (cordophanus) v2
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|