Cla97C07G139290 (gene) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGCAATAAGAAAAGAGCTTGAAGATAAACCTGATATGAAGGAGCCATTTTCAGTGGTGAAGTCTAAACGAGCTTTCTTAAAGAGAAAATGGACAACTTTAGACCGACGTTCTGCTGGTGGAATTTTGTTCTTGCATGTGCTTTCTCTCTTGGCTCCATTTCACTACAATTGGGAAGCCTTTTGG ATGGAGGCAATAAGAAAAGAGCTTGAAGATAAACCTGATATGAAGGAGCCATTTTCAGTGGTGAAGTCTAAACGAGCTTTCTTAAAGAGAAAATGGACAACTTTAGACCGACGTTCTGCTGGTGGAATTTTGTTCTTGCATGTGCTTTCTCTCTTGGCTCCATTTCACTACAATTGGGAAGCCTTTTGG ATGGAGGCAATAAGAAAAGAGCTTGAAGATAAACCTGATATGAAGGAGCCATTTTCAGTGGTGAAGTCTAAACGAGCTTTCTTAAAGAGAAAATGGACAACTTTAGACCGACGTTCTGCTGGTGGAATTTTGTTCTTGCATGTGCTTTCTCTCTTGGCTCCATTTCACTACAATTGGGAAGCCTTTTGG MEAIRKELEDKPDMKEPFSVVKSKRAFLKRKWTTLDRRSAGGILFLHVLSLLAPFHYNWEAFW Homology
BLAST of Cla97C07G139290 vs. NCBI nr
Match: XP_022955953.1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Cucurbita moschata] >KAG6581939.1 Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 104.8 bits (260), Expect = 2.9e-19 Identity = 49/63 (77.78%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Cla97C07G139290 vs. NCBI nr
Match: XP_023528301.1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 103.6 bits (257), Expect = 6.4e-19 Identity = 48/63 (76.19%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Cla97C07G139290 vs. NCBI nr
Match: XP_004152341.2 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic [Cucumis sativus] >KGN52907.1 hypothetical protein Csa_014904 [Cucumis sativus]) HSP 1 Score: 101.7 bits (252), Expect = 2.4e-18 Identity = 47/63 (74.60%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Cla97C07G139290 vs. NCBI nr
Match: XP_022153467.1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Momordica charantia]) HSP 1 Score: 97.4 bits (241), Expect = 4.6e-17 Identity = 47/63 (74.60%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Cla97C07G139290 vs. NCBI nr
Match: XP_022153442.1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like [Momordica charantia]) HSP 1 Score: 90.9 bits (224), Expect = 4.3e-15 Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy Swiss-Prot
Match: Q9FPD5 (Delta-9 desaturase-like 3 protein OS=Arabidopsis thaliana OX=3702 GN=At1g06120 PE=2 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.2e-06 Identity = 24/44 (54.55%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy Swiss-Prot
Match: Q9LVZ3 (Probable lipid desaturase ADS3.2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADS3.2 PE=2 SV=3) HSP 1 Score: 52.0 bits (123), Expect = 2.9e-06 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy Swiss-Prot
Match: Q9LND8 (Delta-9 desaturase-like 2 protein OS=Arabidopsis thaliana OX=3702 GN=At1g06100 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 3.8e-06 Identity = 24/44 (54.55%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy Swiss-Prot
Match: Q9LND9 (Delta-9 desaturase-like 1 protein OS=Arabidopsis thaliana OX=3702 GN=At1g06090 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 4.2e-05 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy Swiss-Prot
Match: Q9FV68 (Icosanoyl-CoA 5-desaturase (Fragment) OS=Limnanthes douglasii OX=28973 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 9.3e-05 Identity = 17/42 (40.48%), Postives = 29/42 (69.05%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy TrEMBL
Match: A0A6J1GVF3 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111457787 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 1.4e-19 Identity = 49/63 (77.78%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy TrEMBL
Match: A0A0A0KWV4 (Delta 9 desaturase OS=Cucumis sativus OX=3659 GN=Csa_4G006140 PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.2e-18 Identity = 47/63 (74.60%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy TrEMBL
Match: A0A6J1DIZ7 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Momordica charantia OX=3673 GN=LOC111020970 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 2.2e-17 Identity = 47/63 (74.60%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy TrEMBL
Match: A0A6J1DIX0 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Momordica charantia OX=3673 GN=LOC111020949 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 2.1e-15 Identity = 48/67 (71.64%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of Cla97C07G139290 vs. ExPASy TrEMBL
Match: A0A6J1GCE1 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111452892 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.8e-11 Identity = 36/49 (73.47%), Postives = 38/49 (77.55%), Query Frame = 0
BLAST of Cla97C07G139290 vs. TAIR 10
Match: AT1G06120.1 (Fatty acid desaturase family protein ) HSP 1 Score: 52.4 bits (124), Expect = 1.6e-07 Identity = 24/44 (54.55%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of Cla97C07G139290 vs. TAIR 10
Match: AT3G15870.1 (Fatty acid desaturase family protein ) HSP 1 Score: 52.0 bits (123), Expect = 2.0e-07 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of Cla97C07G139290 vs. TAIR 10
Match: AT1G06100.1 (Fatty acid desaturase family protein ) HSP 1 Score: 51.6 bits (122), Expect = 2.7e-07 Identity = 24/44 (54.55%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of Cla97C07G139290 vs. TAIR 10
Match: AT1G06090.1 (Fatty acid desaturase family protein ) HSP 1 Score: 48.1 bits (113), Expect = 3.0e-06 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0
BLAST of Cla97C07G139290 vs. TAIR 10
Match: AT1G06080.1 (delta 9 desaturase 1 ) HSP 1 Score: 45.8 bits (107), Expect = 1.5e-05 Identity = 24/61 (39.34%), Postives = 33/61 (54.10%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|