Cla97C06G117050 (gene) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTCTCGGGGTAACAAGAGGCCTTCTATCACCAATGGCGATGACAATTTAGGCGTCCTGTCTAGGGTTTCCCGTTCCGTCTCTGATTCCCAAATCGTCCGACGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACCCAAAAACTCCTCCGTAGCACCGGTAAAGCTGCTTGGATTGCTGGGACGACTTTTCTCATCTTGGTGGTGCCACTCATCATTGAGATGGATCGCGAACAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTCTACTTGGTACCCCGGCCACCGCTGCTCCTAAATGA ATGGCGTCTCGGGGTAACAAGAGGCCTTCTATCACCAATGGCGATGACAATTTAGGCGTCCTGTCTAGGGTTTCCCGTTCCGTCTCTGATTCCCAAATCGTCCGACGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACCCAAAAACTCCTCCGTAGCACCGGTAAAGCTGCTTGGATTGCTGGGACGACTTTTCTCATCTTGGTGGTGCCACTCATCATTGAGATGGATCGCGAACAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTCTACTTGGTACCCCGGCCACCGCTGCTCCTAAATGA ATGGCGTCTCGGGGTAACAAGAGGCCTTCTATCACCAATGGCGATGACAATTTAGGCGTCCTGTCTAGGGTTTCCCGTTCCGTCTCTGATTCCCAAATCGTCCGACGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACCCAAAAACTCCTCCGTAGCACCGGTAAAGCTGCTTGGATTGCTGGGACGACTTTTCTCATCTTGGTGGTGCCACTCATCATTGAGATGGATCGCGAACAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTCTACTTGGTACCCCGGCCACCGCTGCTCCTAAATGA MASRGNKRPSITNGDDNLGVLSRVSRSVSDSQIVRRAKSTASDAAFVTQKLLRSTGKAAWIAGTTFLILVVPLIIEMDREQQFNELEMQQASLLGTPATAAPK Homology
BLAST of Cla97C06G117050 vs. NCBI nr
Match: XP_038875758.1 (mitochondrial import receptor subunit TOM9-2-like [Benincasa hispida]) HSP 1 Score: 189.5 bits (480), Expect = 1.4e-44 Identity = 102/103 (99.03%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Cla97C06G117050 vs. NCBI nr
Match: XP_023006088.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita maxima]) HSP 1 Score: 189.1 bits (479), Expect = 1.9e-44 Identity = 101/103 (98.06%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Cla97C06G117050 vs. NCBI nr
Match: XP_022959104.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita moschata]) HSP 1 Score: 189.1 bits (479), Expect = 1.9e-44 Identity = 101/103 (98.06%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Cla97C06G117050 vs. NCBI nr
Match: XP_023548768.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita pepo subsp. pepo] >KAG6574890.1 Mitochondrial import receptor subunit TOM9-2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7013462.1 Mitochondrial import receptor subunit TOM9-2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 189.1 bits (479), Expect = 1.9e-44 Identity = 101/103 (98.06%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Cla97C06G117050 vs. NCBI nr
Match: XP_023514145.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 187.6 bits (475), Expect = 5.5e-44 Identity = 100/103 (97.09%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Cla97C06G117050 vs. ExPASy Swiss-Prot
Match: Q9FNC9 (Mitochondrial import receptor subunit TOM9-2 OS=Arabidopsis thaliana OX=3702 GN=TOM9-2 PE=1 SV=3) HSP 1 Score: 99.8 bits (247), Expect = 2.0e-20 Identity = 56/84 (66.67%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Cla97C06G117050 vs. ExPASy Swiss-Prot
Match: O64497 (Mitochondrial import receptor subunit TOM9-1 OS=Arabidopsis thaliana OX=3702 GN=TOM9-1 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.2e-16 Identity = 42/80 (52.50%), Postives = 60/80 (75.00%), Query Frame = 0
BLAST of Cla97C06G117050 vs. ExPASy TrEMBL
Match: A0A6J1L3Y9 (mitochondrial import receptor subunit TOM9-2-like OS=Cucurbita maxima OX=3661 GN=LOC111498936 PE=3 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 9.1e-45 Identity = 101/103 (98.06%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Cla97C06G117050 vs. ExPASy TrEMBL
Match: A0A6J1H712 (mitochondrial import receptor subunit TOM9-2-like OS=Cucurbita moschata OX=3662 GN=LOC111460199 PE=3 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 9.1e-45 Identity = 101/103 (98.06%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Cla97C06G117050 vs. ExPASy TrEMBL
Match: A0A5D3CY80 (Mitochondrial import receptor subunit TOM9-2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold96G00090 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 2.2e-43 Identity = 98/103 (95.15%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of Cla97C06G117050 vs. ExPASy TrEMBL
Match: A0A0A0LNL3 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G171830 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 2.2e-43 Identity = 98/103 (95.15%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of Cla97C06G117050 vs. ExPASy TrEMBL
Match: A0A6J1HNI4 (mitochondrial import receptor subunit TOM9-2-like OS=Cucurbita moschata OX=3662 GN=LOC111464536 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 2.2e-43 Identity = 97/103 (94.17%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of Cla97C06G117050 vs. TAIR 10
Match: AT5G43970.1 (translocase of outer membrane 22-V ) HSP 1 Score: 99.8 bits (247), Expect = 1.4e-21 Identity = 56/84 (66.67%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Cla97C06G117050 vs. TAIR 10
Match: AT1G04070.1 (translocase of outer membrane 22-I ) HSP 1 Score: 86.3 bits (212), Expect = 1.6e-17 Identity = 42/80 (52.50%), Postives = 60/80 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|