
Cla97C06G114130 (gene) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAATCACGCAAAGCCCATAAGAACGGCATCAAGAAACCAAGGAAGCACCGCCATACTTCCACCAAAGGGGTATGAGTTTTTTCTCATACAATCACTTCTCTTCTTGTTCAATCCATTGTTTTATTTTTTCAATAGTTTTAATTCCTTGTCTCGTCGATTTGTCGATTTGTGTATAGATGGATCCGAAGTTCCTTAGGAATCAGAGGTACGCGAAGAAACACAATAATAAGAGTGGGGAAAATGCTTTTGAGGAAGAGTAAACTAGACAGCTATGTAGCCGCCAAGTTTAGGGTTTTTATGATATGAGTTTTTCTTATATTGAATCTTTTGTTATTGCTCTTCTTTTTGTTCAGTAGTCTTGCTATTTTGACTCAATGTGGAAACTGTTGCTTCTGA ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAATCACGCAAAGCCCATAAGAACGGCATCAAGAAACCAAGGAAGCACCGCCATACTTCCACCAAAGGGATGGATCCGAAGTTCCTTAGGAATCAGAGGTACGCGAAGAAACACAATAATAAGAGTGGGGAAAATGCTTTTGAGGAAGATAGTCTTGCTATTTTGACTCAATGTGGAAACTGTTGCTTCTGA ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAATCACGCAAAGCCCATAAGAACGGCATCAAGAAACCAAGGAAGCACCGCCATACTTCCACCAAAGGGATGGATCCGAAGTTCCTTAGGAATCAGAGGTACGCGAAGAAACACAATAATAAGAGTGGGGAAAATGCTTTTGAGGAAGATAGTCTTGCTATTTTGACTCAATGTGGAAACTGTTGCTTCTGA MAKSKNHTAHNQSRKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNNKSGENAFEEDSLAILTQCGNCCF Homology
BLAST of Cla97C06G114130 vs. NCBI nr
Match: XP_038875270.1 (60S ribosomal protein L29-1 [Benincasa hispida]) HSP 1 Score: 117.9 bits (294), Expect = 3.8e-23 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C06G114130 vs. NCBI nr
Match: XP_038875325.1 (60S ribosomal protein L29-1-like [Benincasa hispida]) HSP 1 Score: 115.5 bits (288), Expect = 1.9e-22 Identity = 58/61 (95.08%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114130 vs. NCBI nr
Match: XP_023000055.1 (60S ribosomal protein L29-1 [Cucurbita maxima] >XP_023514069.1 60S ribosomal protein L29-1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.4 bits (285), Expect = 4.2e-22 Identity = 57/61 (93.44%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114130 vs. NCBI nr
Match: XP_022930218.1 (60S ribosomal protein L29-1 [Cucurbita moschata] >KAG7026348.1 60S ribosomal protein L29-1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 113.6 bits (283), Expect = 7.2e-22 Identity = 57/60 (95.00%), Postives = 58/60 (96.67%), Query Frame = 0
BLAST of Cla97C06G114130 vs. NCBI nr
Match: XP_023000056.1 (60S ribosomal protein L29-1-like [Cucurbita maxima] >KAG7026347.1 60S ribosomal protein L29-1 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 113.2 bits (282), Expect = 9.4e-22 Identity = 56/61 (91.80%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy Swiss-Prot
Match: Q84WM0 (60S ribosomal protein L29-2 OS=Arabidopsis thaliana OX=3702 GN=RPL29B PE=3 SV=2) HSP 1 Score: 103.6 bits (257), Expect = 9.8e-22 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy Swiss-Prot
Match: Q9M7X7 (60S ribosomal protein L29-1 OS=Arabidopsis thaliana OX=3702 GN=RPL29A PE=1 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.3e-21 Identity = 51/61 (83.61%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy Swiss-Prot
Match: Q58DW3 (60S ribosomal protein L29 OS=Bos taurus OX=9913 GN=RPL29 PE=2 SV=3) HSP 1 Score: 79.7 bits (195), Expect = 1.5e-14 Identity = 40/52 (76.92%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy Swiss-Prot
Match: P47914 (60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2) HSP 1 Score: 79.7 bits (195), Expect = 1.5e-14 Identity = 40/52 (76.92%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy Swiss-Prot
Match: Q8HXB8 (60S ribosomal protein L29 OS=Macaca fascicularis OX=9541 GN=RPL29 PE=2 SV=3) HSP 1 Score: 79.7 bits (195), Expect = 1.5e-14 Identity = 40/52 (76.92%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy TrEMBL
Match: A0A6J1KHA4 (60S ribosomal protein L29 OS=Cucurbita maxima OX=3661 GN=LOC111494362 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 2.0e-22 Identity = 57/61 (93.44%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy TrEMBL
Match: A0A6J1EUF7 (60S ribosomal protein L29 OS=Cucurbita moschata OX=3662 GN=LOC111436738 PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 3.5e-22 Identity = 57/60 (95.00%), Postives = 58/60 (96.67%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy TrEMBL
Match: A0A6J1KET9 (60S ribosomal protein L29 OS=Cucurbita maxima OX=3661 GN=LOC111494363 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 4.6e-22 Identity = 56/61 (91.80%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy TrEMBL
Match: A0A6J1L4P4 (60S ribosomal protein L29 OS=Cucurbita maxima OX=3661 GN=LOC111499112 PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.0e-22 Identity = 56/61 (91.80%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Cla97C06G114130 vs. ExPASy TrEMBL
Match: A0A6J1H4N3 (60S ribosomal protein L29 OS=Cucurbita moschata OX=3662 GN=LOC111460442 PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.0e-22 Identity = 56/61 (91.80%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Cla97C06G114130 vs. TAIR 10
Match: AT3G06680.1 (Ribosomal L29e protein family ) HSP 1 Score: 103.6 bits (257), Expect = 7.0e-23 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cla97C06G114130 vs. TAIR 10
Match: AT3G06680.2 (Ribosomal L29e protein family ) HSP 1 Score: 103.6 bits (257), Expect = 7.0e-23 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cla97C06G114130 vs. TAIR 10
Match: AT3G06680.3 (Ribosomal L29e protein family ) HSP 1 Score: 103.6 bits (257), Expect = 7.0e-23 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cla97C06G114130 vs. TAIR 10
Match: AT3G06700.1 (Ribosomal L29e protein family ) HSP 1 Score: 103.2 bits (256), Expect = 9.1e-23 Identity = 51/61 (83.61%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cla97C06G114130 vs. TAIR 10
Match: AT3G06700.2 (Ribosomal L29e protein family ) HSP 1 Score: 103.2 bits (256), Expect = 9.1e-23 Identity = 51/61 (83.61%), Postives = 56/61 (91.80%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|