Chy11G200850 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCAACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGACTACTCGTTACCTAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGTTCTCGCCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA ATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCAACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGACTACTCGTTACCTAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGTTCTCGCCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA ATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCAACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGACTACTCGTTACCTAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGTTCTCGCCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA MAAAVDFSGDHELLFVPTTSDFFNDNDDFGFGMEFQMDSEINRRILATTRYLSYGALRRNNVPCSRRGASYYNCRPGAQANPYTRGCSAITRCRS* Homology
BLAST of Chy11G200850 vs. ExPASy Swiss-Prot
Match: Q9LUS7 (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-26 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy Swiss-Prot
Match: Q8L9P8 (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.3e-26 Identity = 55/61 (90.16%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy Swiss-Prot
Match: Q945T0 (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.5e-25 Identity = 51/62 (82.26%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy Swiss-Prot
Match: Q9SRY3 (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.7e-23 Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy Swiss-Prot
Match: Q9MA62 (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.7e-22 Identity = 46/61 (75.41%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy TrEMBL
Match: A0A0A0KBU7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194150 PE=3 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 4.1e-47 Identity = 93/95 (97.89%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy TrEMBL
Match: A0A1S3C7V8 (protein RALF-like 33 OS=Cucumis melo OX=3656 GN=LOC103497855 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.1e-47 Identity = 92/95 (96.84%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy TrEMBL
Match: A0A6J1H3W7 (protein RALF-like 33 OS=Cucurbita moschata OX=3662 GN=LOC111460267 PE=3 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 2.9e-37 Identity = 80/103 (77.67%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy TrEMBL
Match: A0A6J1KVY0 (protein RALF-like 33 OS=Cucurbita maxima OX=3661 GN=LOC111499183 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 1.5e-36 Identity = 81/103 (78.64%), Postives = 87/103 (84.47%), Query Frame = 0
BLAST of Chy11G200850 vs. ExPASy TrEMBL
Match: A0A6J1C9N4 (protein RALF-like 33 OS=Momordica charantia OX=3673 GN=LOC111009595 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 7.4e-33 Identity = 73/101 (72.28%), Postives = 81/101 (80.20%), Query Frame = 0
BLAST of Chy11G200850 vs. NCBI nr
Match: XP_004143090.1 (protein RALF-like 33 [Cucumis sativus] >KGN47180.1 hypothetical protein Csa_020637 [Cucumis sativus]) HSP 1 Score: 194 bits (493), Expect = 4.20e-62 Identity = 93/95 (97.89%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of Chy11G200850 vs. NCBI nr
Match: XP_008458453.1 (PREDICTED: protein RALF-like 33 [Cucumis melo]) HSP 1 Score: 193 bits (490), Expect = 1.24e-61 Identity = 92/95 (96.84%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of Chy11G200850 vs. NCBI nr
Match: XP_023547686.1 (protein RALF-like 33 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 162 bits (409), Expect = 3.59e-49 Identity = 80/103 (77.67%), Postives = 87/103 (84.47%), Query Frame = 0
BLAST of Chy11G200850 vs. NCBI nr
Match: XP_022959207.1 (protein RALF-like 33 [Cucurbita moschata]) HSP 1 Score: 161 bits (408), Expect = 5.09e-49 Identity = 80/103 (77.67%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of Chy11G200850 vs. NCBI nr
Match: KAG6575064.1 (Protein RALF-like 33, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 160 bits (404), Expect = 2.07e-48 Identity = 79/103 (76.70%), Postives = 87/103 (84.47%), Query Frame = 0
BLAST of Chy11G200850 vs. TAIR 10
Match: AT3G16570.1 (rapid alkalinization factor 23 ) HSP 1 Score: 120.6 bits (301), Expect = 7.1e-28 Identity = 55/63 (87.30%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of Chy11G200850 vs. TAIR 10
Match: AT4G15800.1 (ralf-like 33 ) HSP 1 Score: 120.2 bits (300), Expect = 9.3e-28 Identity = 55/61 (90.16%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Chy11G200850 vs. TAIR 10
Match: AT1G02900.1 (rapid alkalinization factor 1 ) HSP 1 Score: 107.8 bits (268), Expect = 4.8e-24 Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Chy11G200850 vs. TAIR 10
Match: AT3G05490.1 (ralf-like 22 ) HSP 1 Score: 104.8 bits (260), Expect = 4.0e-23 Identity = 46/61 (75.41%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Chy11G200850 vs. TAIR 10
Match: AT2G33775.1 (ralf-like 19 ) HSP 1 Score: 88.6 bits (218), Expect = 3.0e-18 Identity = 41/62 (66.13%), Postives = 49/62 (79.03%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|