Chy10G183500 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCCCACCAAAATCTTCCGAAATCAATGGCCCTCGCCCTTCTCCTCTCTTAATCCACAACGATTCTCGTCTTATTCGTAAGCCCCCCCAGCTCCGGCAGCCACTCATCATTTACACCCATTCCCCCAAAATCATCCACACCCACCCTAAGGATTTCATGGCATTGGTTCAACGCCTCACTGGCTGCAACCCACCACCGCCGCTGCCGCTGCCGTCTGACAAACCCTCCTTGTCGGAGAGAAATTTGAACGACAACGATTCATCGTCGGGTGTGACGACGGAGGAGGATATTAATGAAAAACAGAGTAATTGTTCTGTTCTTAAATATTCTTCTCATGATGTTACGACGCCGTTTTCCTCCCCTGCTTTCCTTTGCTCCTCCTTATCCCCTTCTTTCATGGACTTTCTTAAAGCCCTCCCTGAATTTTAA ATGAGCCCACCAAAATCTTCCGAAATCAATGGCCCTCGCCCTTCTCCTCTCTTAATCCACAACGATTCTCGTCTTATTCGTAAGCCCCCCCAGCTCCGGCAGCCACTCATCATTTACACCCATTCCCCCAAAATCATCCACACCCACCCTAAGGATTTCATGGCATTGGTTCAACGCCTCACTGGCTGCAACCCACCACCGCCGCTGCCGCTGCCGTCTGACAAACCCTCCTTGTCGGAGAGAAATTTGAACGACAACGATTCATCGTCGGGTGTGACGACGGAGGAGGATATTAATGAAAAACAGAGTAATTGTTCTGTTCTTAAATATTCTTCTCATGATGTTACGACGCCGTTTTCCTCCCCTGCTTTCCTTTGCTCCTCCTTATCCCCTTCTTTCATGGACTTTCTTAAAGCCCTCCCTGAATTTTAA ATGAGCCCACCAAAATCTTCCGAAATCAATGGCCCTCGCCCTTCTCCTCTCTTAATCCACAACGATTCTCGTCTTATTCGTAAGCCCCCCCAGCTCCGGCAGCCACTCATCATTTACACCCATTCCCCCAAAATCATCCACACCCACCCTAAGGATTTCATGGCATTGGTTCAACGCCTCACTGGCTGCAACCCACCACCGCCGCTGCCGCTGCCGTCTGACAAACCCTCCTTGTCGGAGAGAAATTTGAACGACAACGATTCATCGTCGGGTGTGACGACGGAGGAGGATATTAATGAAAAACAGAGTAATTGTTCTGTTCTTAAATATTCTTCTCATGATGTTACGACGCCGTTTTCCTCCCCTGCTTTCCTTTGCTCCTCCTTATCCCCTTCTTTCATGGACTTTCTTAAAGCCCTCCCTGAATTTTAA MSPPKSSEINGPRPSPLLIHNDSRLIRKPPQLRQPLIIYTHSPKIIHTHPKDFMALVQRLTGCNPPPPLPLPSDKPSLSERNLNDNDSSSGVTTEEDINEKQSNCSVLKYSSHDVTTPFSSPAFLCSSLSPSFMDFLKALPEF* Homology
BLAST of Chy10G183500 vs. ExPASy Swiss-Prot
Match: Q9LS54 (VQ motif-containing protein 20 OS=Arabidopsis thaliana OX=3702 GN=VQ20 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 8.9e-11 Identity = 33/60 (55.00%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy Swiss-Prot
Match: Q9CA36 (VQ motif-containing protein 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VQ8 PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 3.4e-10 Identity = 50/149 (33.56%), Postives = 73/149 (48.99%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy Swiss-Prot
Match: Q8LGD5 (Protein MKS1 OS=Arabidopsis thaliana OX=3702 GN=MKS1 PE=1 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 4.9e-09 Identity = 31/70 (44.29%), Postives = 42/70 (60.00%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy Swiss-Prot
Match: F4HWF9 (Nuclear speckle RNA-binding protein B OS=Arabidopsis thaliana OX=3702 GN=NSRB PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 9.2e-08 Identity = 35/82 (42.68%), Postives = 46/82 (56.10%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy TrEMBL
Match: A0A0A0KT78 (VQ domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G609750 PE=4 SV=1) HSP 1 Score: 275.4 bits (703), Expect = 1.3e-70 Identity = 139/143 (97.20%), Postives = 139/143 (97.20%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy TrEMBL
Match: A0A5D3CFH5 (VQ motif-containing protein 8 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold475G001070 PE=4 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 4.7e-55 Identity = 122/143 (85.31%), Postives = 127/143 (88.81%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy TrEMBL
Match: A0A1S3CS67 (VQ motif-containing protein 8, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103504155 PE=4 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 4.7e-55 Identity = 122/143 (85.31%), Postives = 127/143 (88.81%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy TrEMBL
Match: A0A6J1DC48 (VQ motif-containing protein 8, chloroplastic OS=Momordica charantia OX=3673 GN=LOC111018730 PE=4 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 3.6e-31 Identity = 97/167 (58.08%), Postives = 107/167 (64.07%), Query Frame = 0
BLAST of Chy10G183500 vs. ExPASy TrEMBL
Match: W9RYA3 (VQ domain-containing protein OS=Morus notabilis OX=981085 GN=L484_015429 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 7.3e-16 Identity = 69/191 (36.13%), Postives = 94/191 (49.21%), Query Frame = 0
BLAST of Chy10G183500 vs. NCBI nr
Match: XP_008466850.1 (PREDICTED: VQ motif-containing protein 8, chloroplastic-like [Cucumis melo] >KAA0034563.1 VQ motif-containing protein 8 [Cucumis melo var. makuwa] >TYK09116.1 VQ motif-containing protein 8 [Cucumis melo var. makuwa]) HSP 1 Score: 221 bits (564), Expect = 6.80e-72 Identity = 122/143 (85.31%), Postives = 127/143 (88.81%), Query Frame = 0
BLAST of Chy10G183500 vs. NCBI nr
Match: XP_038893302.1 (VQ motif-containing protein 8, chloroplastic [Benincasa hispida]) HSP 1 Score: 200 bits (509), Expect = 3.69e-63 Identity = 119/160 (74.38%), Postives = 128/160 (80.00%), Query Frame = 0
BLAST of Chy10G183500 vs. NCBI nr
Match: KGN52621.2 (hypothetical protein Csa_008052 [Cucumis sativus]) HSP 1 Score: 197 bits (500), Expect = 1.66e-62 Identity = 99/102 (97.06%), Postives = 99/102 (97.06%), Query Frame = 0
BLAST of Chy10G183500 vs. NCBI nr
Match: XP_022150646.1 (VQ motif-containing protein 8, chloroplastic [Momordica charantia]) HSP 1 Score: 142 bits (359), Expect = 2.88e-40 Identity = 97/167 (58.08%), Postives = 107/167 (64.07%), Query Frame = 0
BLAST of Chy10G183500 vs. NCBI nr
Match: KAG7013019.1 (VQ motif-containing protein 8, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 139 bits (350), Expect = 1.70e-39 Identity = 84/146 (57.53%), Postives = 93/146 (63.70%), Query Frame = 0
BLAST of Chy10G183500 vs. TAIR 10
Match: AT3G18360.1 (VQ motif-containing protein ) HSP 1 Score: 68.2 bits (165), Expect = 6.3e-12 Identity = 33/60 (55.00%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of Chy10G183500 vs. TAIR 10
Match: AT1G68450.1 (VQ motif-containing protein ) HSP 1 Score: 66.2 bits (160), Expect = 2.4e-11 Identity = 50/149 (33.56%), Postives = 73/149 (48.99%), Query Frame = 0
BLAST of Chy10G183500 vs. TAIR 10
Match: AT1G21326.1 (VQ motif-containing protein ) HSP 1 Score: 64.3 bits (155), Expect = 9.1e-11 Identity = 39/82 (47.56%), Postives = 47/82 (57.32%), Query Frame = 0
BLAST of Chy10G183500 vs. TAIR 10
Match: AT3G18690.1 (MAP kinase substrate 1 ) HSP 1 Score: 62.4 bits (150), Expect = 3.5e-10 Identity = 31/70 (44.29%), Postives = 42/70 (60.00%), Query Frame = 0
BLAST of Chy10G183500 vs. TAIR 10
Match: AT1G21320.1 (nucleotide binding;nucleic acid binding ) HSP 1 Score: 58.2 bits (139), Expect = 6.5e-09 Identity = 35/82 (42.68%), Postives = 46/82 (56.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|