CcUC05G086220 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTACAACATGCAAAGGTACATGAGTAATATTACATCATTAAGCCATCTTCAGTTTTTTAAAATTCTACTTATTCTAATTTTATCATTTTTTTTACAATAATTTTTCGTCTTTCTTAAAAAAAATATTTGAATTTAAAATTTAATTTAAGAACACACAAAGTCAAGTTTTCAAGAACTATGCGTAGTTAGATTTTGGATTTTTAAAACTAGGTTTATTTGTAAACATTATTTTTATATATAGATTTCTTTGTTTTTGTTATTCAACTTATACGAGCTTAAATTTATGAAAAAAGAAATTAATATATGGTTTTGTATGTTTTACTTTTAGGAAAGAGTTCATGGCCGGAGTTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGTGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCGTAGTCACTAGGACTCCTTTCATTGGTTAA ATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAGTTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGTGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCGTAGTCACTAGGACTCCTTTCATTGGTTAA ATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAGTTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGTGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCGTAGTCACTAGGACTCCTTTCATTGGTTAA MSTTCKGKSSWPELVGKAGKEAEKIIEKENPLVDAIIVDEGSMVILDFRCDRVWVWVDSKTGVVTRTPFIG Homology
BLAST of CcUC05G086220 vs. NCBI nr
Match: XP_004134090.1 (glu S.griseus protease inhibitor [Cucumis sativus]) HSP 1 Score: 137.9 bits (346), Expect = 3.4e-29 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of CcUC05G086220 vs. NCBI nr
Match: KAE8650342.1 (hypothetical protein Csa_009611 [Cucumis sativus]) HSP 1 Score: 137.9 bits (346), Expect = 3.4e-29 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of CcUC05G086220 vs. NCBI nr
Match: KAA0049295.1 (inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa] >TYK17263.1 inhibitor of trypsin and hageman factor-like [Cucumis melo var. makuwa]) HSP 1 Score: 137.5 bits (345), Expect = 4.5e-29 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of CcUC05G086220 vs. NCBI nr
Match: KAG6582359.1 (hypothetical protein SDJN03_22361, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 136.0 bits (341), Expect = 1.3e-28 Identity = 63/71 (88.73%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of CcUC05G086220 vs. NCBI nr
Match: KAG6582360.1 (hypothetical protein SDJN03_22362, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 118.6 bits (296), Expect = 2.2e-23 Identity = 55/69 (79.71%), Postives = 60/69 (86.96%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy Swiss-Prot
Match: P24076 (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.5e-15 Identity = 39/67 (58.21%), Postives = 48/67 (71.64%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy Swiss-Prot
Match: P80211 (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.2e-14 Identity = 40/64 (62.50%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.2e-14 Identity = 37/69 (53.62%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.1e-13 Identity = 38/69 (55.07%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy Swiss-Prot
Match: P86971 (Trypsin inhibitor OS=Fagopyrum tataricum OX=62330 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.1e-09 Identity = 34/72 (47.22%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy TrEMBL
Match: A0A0A0L795 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 1.7e-29 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy TrEMBL
Match: A0A5D3CZE2 (Inhibitor of trypsin and hageman factor-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001160 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 2.2e-29 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy TrEMBL
Match: A0A5D3D207 (Inhibitor of trypsin and hageman factor-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001170 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.0e-23 Identity = 54/71 (76.06%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy TrEMBL
Match: B1ACD2 (Putative protease inhibitor OS=Glycine max OX=3847 GN=100170748 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 9.1e-20 Identity = 51/71 (71.83%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of CcUC05G086220 vs. ExPASy TrEMBL
Match: A0A445IPH9 (Inhibitor of trypsin and hageman factor OS=Glycine soja OX=3848 GN=D0Y65_027448 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 9.1e-20 Identity = 51/71 (71.83%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of CcUC05G086220 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 73.2 bits (178), Expect = 9.7e-14 Identity = 37/71 (52.11%), Postives = 47/71 (66.20%), Query Frame = 0
BLAST of CcUC05G086220 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 71.2 bits (173), Expect = 3.7e-13 Identity = 34/73 (46.58%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of CcUC05G086220 vs. TAIR 10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.0e-11 Identity = 35/74 (47.30%), Postives = 50/74 (67.57%), Query Frame = 0
BLAST of CcUC05G086220 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 55.1 bits (131), Expect = 2.7e-08 Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of CcUC05G086220 vs. TAIR 10
Match: AT3G50020.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 44.7 bits (104), Expect = 3.7e-05 Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|