CcUC04G062980 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGATGACCAGTGTAGTGACTATTGACGACGATAACATTAGAAGAACTAAGTCATATATAGCACCGGAGTCATTGAGGGATAGTTACTTTGATACGTCTGTTGATGTATGGGCACTTGGATGCATGGTGTTGGAGATGTTGACTAGAAAACAAGTGTGGAGTTCTAAAAAGTTCCATCTTGATATGCTCACTTATATTAATCATAGTAACAAATTTTCAGACATGCTAAATGGGTTATCACCCATGGCAATTGATTTTTTGAGAAGATGTTTGGTAAAAAATCCTTACAAAAGATCGACGCCATGA ATGGAGATGACCAGTGTAGTGACTATTGACGACGATAACATTAGAAGAACTAAGTCATATATAGCACCGGAGTCATTGAGGGATAGTTACTTTGATACGTCTGTTGATGTATGGGCACTTGGATGCATGGTGTTGGAGATGTTGACTAGAAAACAAGTGTGGAGTTCTAAAAAGTTCCATCTTGATATGCTCACTTATATTAATCATAGTAACAAATTTTCAGACATGCTAAATGGGTTATCACCCATGGCAATTGATTTTTTGAGAAGATGTTTGGTAAAAAATCCTTACAAAAGATCGACGCCATGA ATGGAGATGACCAGTGTAGTGACTATTGACGACGATAACATTAGAAGAACTAAGTCATATATAGCACCGGAGTCATTGAGGGATAGTTACTTTGATACGTCTGTTGATGTATGGGCACTTGGATGCATGGTGTTGGAGATGTTGACTAGAAAACAAGTGTGGAGTTCTAAAAAGTTCCATCTTGATATGCTCACTTATATTAATCATAGTAACAAATTTTCAGACATGCTAAATGGGTTATCACCCATGGCAATTGATTTTTTGAGAAGATGTTTGGTAAAAAATCCTTACAAAAGATCGACGCCATGA MEMTSVVTIDDDNIRRTKSYIAPESLRDSYFDTSVDVWALGCMVLEMLTRKQVWSSKKFHLDMLTYINHSNKFSDMLNGLSPMAIDFLRRCLVKNPYKRSTP Homology
BLAST of CcUC04G062980 vs. NCBI nr
Match: XP_038882353.1 (mitogen-activated protein kinase kinase kinase 3-like [Benincasa hispida]) HSP 1 Score: 114.0 bits (284), Expect = 7.6e-22 Identity = 57/102 (55.88%), Postives = 78/102 (76.47%), Query Frame = 0
BLAST of CcUC04G062980 vs. NCBI nr
Match: XP_022159256.1 (mitogen-activated protein kinase kinase kinase 17 [Momordica charantia]) HSP 1 Score: 85.5 bits (210), Expect = 2.9e-13 Identity = 40/80 (50.00%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of CcUC04G062980 vs. NCBI nr
Match: KAG6589837.1 (Mitogen-activated protein kinase kinase kinase 20, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 79.7 bits (195), Expect = 1.6e-11 Identity = 37/89 (41.57%), Postives = 57/89 (64.04%), Query Frame = 0
BLAST of CcUC04G062980 vs. NCBI nr
Match: XP_022960664.1 (mitogen-activated protein kinase kinase kinase 17-like [Cucurbita moschata]) HSP 1 Score: 79.7 bits (195), Expect = 1.6e-11 Identity = 37/89 (41.57%), Postives = 57/89 (64.04%), Query Frame = 0
BLAST of CcUC04G062980 vs. NCBI nr
Match: KAG7023508.1 (Mitogen-activated protein kinase kinase kinase 17, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 79.7 bits (195), Expect = 1.6e-11 Identity = 37/89 (41.57%), Postives = 57/89 (64.04%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy Swiss-Prot
Match: Q9SND6 (Mitogen-activated protein kinase kinase kinase 20 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK20 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.8e-11 Identity = 36/90 (40.00%), Postives = 52/90 (57.78%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy Swiss-Prot
Match: Q9CAD5 (Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.0e-08 Identity = 32/83 (38.55%), Postives = 51/83 (61.45%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy Swiss-Prot
Match: O22042 (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.9e-08 Identity = 29/87 (33.33%), Postives = 46/87 (52.87%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy Swiss-Prot
Match: Q54R82 (Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2) HSP 1 Score: 57.4 bits (137), Expect = 1.1e-07 Identity = 26/87 (29.89%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy Swiss-Prot
Match: P53599 (MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSK2 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.1e-07 Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy TrEMBL
Match: A0A6J1E3D1 (mitogen-activated protein kinase kinase kinase 17 OS=Momordica charantia OX=3673 GN=LOC111025669 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 1.4e-13 Identity = 40/80 (50.00%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy TrEMBL
Match: A0A6J1HBP5 (mitogen-activated protein kinase kinase kinase 17-like OS=Cucurbita moschata OX=3662 GN=LOC111461386 PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 7.7e-12 Identity = 37/89 (41.57%), Postives = 57/89 (64.04%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy TrEMBL
Match: A0A6J1JAH8 (mitogen-activated protein kinase kinase kinase 17-like OS=Cucurbita maxima OX=3661 GN=LOC111485031 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.7e-11 Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy TrEMBL
Match: A0A7J7HV91 (Uncharacterized protein OS=Camellia sinensis OX=4442 GN=HYC85_008850 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 3.8e-11 Identity = 37/90 (41.11%), Postives = 57/90 (63.33%), Query Frame = 0
BLAST of CcUC04G062980 vs. ExPASy TrEMBL
Match: A0A4S4E5X3 (Protein kinase domain-containing protein OS=Camellia sinensis var. sinensis OX=542762 GN=TEA_018510 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 3.8e-11 Identity = 37/90 (41.11%), Postives = 57/90 (63.33%), Query Frame = 0
BLAST of CcUC04G062980 vs. TAIR 10
Match: AT5G67080.1 (mitogen-activated protein kinase kinase kinase 19 ) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-12 Identity = 37/90 (41.11%), Postives = 53/90 (58.89%), Query Frame = 0
BLAST of CcUC04G062980 vs. TAIR 10
Match: AT3G50310.1 (mitogen-activated protein kinase kinase kinase 20 ) HSP 1 Score: 69.3 bits (168), Expect = 2.0e-12 Identity = 36/90 (40.00%), Postives = 52/90 (57.78%), Query Frame = 0
BLAST of CcUC04G062980 vs. TAIR 10
Match: AT3G45670.1 (Protein kinase superfamily protein ) HSP 1 Score: 68.9 bits (167), Expect = 2.6e-12 Identity = 40/91 (43.96%), Postives = 50/91 (54.95%), Query Frame = 0
BLAST of CcUC04G062980 vs. TAIR 10
Match: AT4G04632.1 (Protein kinase superfamily protein ) HSP 1 Score: 67.4 bits (163), Expect = 7.6e-12 Identity = 37/81 (45.68%), Postives = 44/81 (54.32%), Query Frame = 0
BLAST of CcUC04G062980 vs. TAIR 10
Match: AT2G30040.1 (mitogen-activated protein kinase kinase kinase 14 ) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-10 Identity = 34/85 (40.00%), Postives = 47/85 (55.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|