CcUC02G034400 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCAACCTCAAACCCTTTTGAATGTCGTAGATAACAGCGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATCGACGATATGCTCATAATGGTGACGTCATTGTTGCTGTAATCAAGAAAGTCGTCCCAAATACATCTCTAGAAAGATCAGAAGTAATCAGAGCTGTAATTCTACGTATTTGTAAAGAACTCAAACAAGAAAACGATATGATAATACGATATGCCTGTTCAGTTAATTCAATAGCTTTTTTCATTGCTTTGCAAAATGAAACTCTAGTCCTTATCCTATATTAG ATGATTCAACCTCAAACCCTTTTGAATGTCGTAGATAACAGCGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATCGACGATATGCTCATAATGGTGACGTCATTGTTGCTGTAATCAAGAAAGTCGTCCCAAATACATCTCTAGAAAGATCAGAAGTAATCAGAGCTGTAATTCTACGTATTTGTAAAGAACTCAAACAAGAAAACGATATGATAATACGATATGCCTGTTCAGTTAATTCAATAGCTTTTTTCATTGCTTTGCAAAATGAAACTCTAGTCCTTATCCTATATTAG ATGATTCAACCTCAAACCCTTTTGAATGTCGTAGATAACAGCGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATCGACGATATGCTCATAATGGTGACGTCATTGTTGCTGTAATCAAGAAAGTCGTCCCAAATACATCTCTAGAAAGATCAGAAGTAATCAGAGCTGTAATTCTACGTATTTGTAAAGAACTCAAACAAGAAAACGATATGATAATACGATATGCCTGTTCAGTTAATTCAATAGCTTTTTTCATTGCTTTGCAAAATGAAACTCTAGTCCTTATCCTATATTAG MIQPQTLLNVVDNSGARELMCIRIIGASNRRYAHNGDVIVAVIKKVVPNTSLERSEVIRAVILRICKELKQENDMIIRYACSVNSIAFFIALQNETLVLILY Homology
BLAST of CcUC02G034400 vs. NCBI nr
Match: YP_009753040.1 (ribosomal protein L14 [Gerrardanthus macrorhizus] >QIT06112.1 ribosomal protein L14 [Gerrardanthus macrorhizus]) HSP 1 Score: 137.9 bits (346), Expect = 4.9e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. NCBI nr
Match: YP_009430663.1 (ribosomal protein L14 [Gynostemma cardiospermum] >YP_010015175.1 ribosomal protein L14 [Gynostemma yixingense] >ART65099.1 ribosomal protein L14 [Gynostemma cardiospermum] >QOI14300.1 ribosomal protein L14 [Gynostemma yixingense]) HSP 1 Score: 137.9 bits (346), Expect = 4.9e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. NCBI nr
Match: AHM88831.1 (ribosomal protein L14, partial [Lagenaria siceraria] >AHM91189.1 ribosomal protein L14, partial [Lagenaria siceraria]) HSP 1 Score: 137.9 bits (346), Expect = 4.9e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. NCBI nr
Match: YP_009751858.1 (ribosomal protein L14 [Indofevillea khasiana] >QIT04591.1 ribosomal protein L14 [Indofevillea khasiana] >QJS52359.1 ribosomal protein L14 [Indofevillea khasiana]) HSP 1 Score: 137.9 bits (346), Expect = 4.9e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. NCBI nr
Match: YP_009753656.1 (ribosomal protein L14 [Trichosanthes wallichiana] >QIT04675.1 ribosomal protein L14 [Trichosanthes wallichiana]) HSP 1 Score: 137.9 bits (346), Expect = 4.9e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy Swiss-Prot
Match: Q8WKP4 (50S ribosomal protein L14, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl14 PE=2 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 6.5e-32 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy Swiss-Prot
Match: Q3V4Z7 (50S ribosomal protein L14, chloroplastic OS=Acorus calamus OX=4465 GN=rpl14 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 7.1e-31 Identity = 68/79 (86.08%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy Swiss-Prot
Match: B1A971 (50S ribosomal protein L14, chloroplastic OS=Carica papaya OX=3649 GN=rpl14 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 4.6e-30 Identity = 68/79 (86.08%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy Swiss-Prot
Match: Q09ME1 (50S ribosomal protein L14, chloroplastic OS=Citrus sinensis OX=2711 GN=rpl14 PE=3 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 6.0e-30 Identity = 67/79 (84.81%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy Swiss-Prot
Match: Q7YJU2 (50S ribosomal protein L14, chloroplastic OS=Calycanthus floridus var. glaucus OX=212734 GN=rpl14 PE=3 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.3e-29 Identity = 67/79 (84.81%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy TrEMBL
Match: A0A218KG78 (50S ribosomal protein L14, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=rpl14 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.4e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy TrEMBL
Match: A0A6H0ERW9 (50S ribosomal protein L14, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=rpl14 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.4e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy TrEMBL
Match: G3ETT4 (50S ribosomal protein L14, chloroplastic OS=Cucumis melo subsp. melo OX=412675 GN=rpl14 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.4e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy TrEMBL
Match: A0A1X9Q175 (50S ribosomal protein L14, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl14 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.4e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. ExPASy TrEMBL
Match: A0A1S4EU43 (50S ribosomal protein L14, chloroplastic OS=Cucumis melo OX=3656 GN=rpl14 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.4e-29 Identity = 71/79 (89.87%), Postives = 73/79 (92.41%), Query Frame = 0
BLAST of CcUC02G034400 vs. TAIR 10
Match: ATCG00780.1 (ribosomal protein L14 ) HSP 1 Score: 129.8 bits (325), Expect = 1.2e-30 Identity = 66/79 (83.54%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of CcUC02G034400 vs. TAIR 10
Match: AT5G46160.1 (Ribosomal protein L14p/L23e family protein ) HSP 1 Score: 52.4 bits (124), Expect = 2.5e-07 Identity = 27/78 (34.62%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of CcUC02G034400 vs. TAIR 10
Match: AT5G46160.2 (Ribosomal protein L14p/L23e family protein ) HSP 1 Score: 52.4 bits (124), Expect = 2.5e-07 Identity = 27/78 (34.62%), Postives = 49/78 (62.82%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|