
CcUC02G028150 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGGTTTATCAAGAATATGCAAGAAAAGCACTTCAGATTGTTGATTCATCGCCAGAGATGGCTTAGAACCAATAGTTCATTATCTAATGGATTTTTCTGTTCTAATACTCCATTCGAGAGTTATTAATATTTATCAAATTTGTTCCTACCTAAAGGAACACTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAGATGGCTTTCCCTAGATGAAATGAAAATTGGATTC ATGTTGAATATGCAAGAAAAGCACTTCAGATTGTTGATTCATCGCCAGAGATGGCTTAGAACCAATAGTTCATTATCTAATGGATTTTTCTGTTCTAATACTCCATTCGAGAGAACACTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAGATGGCTTTCCCTAGATGAAATGAAAATTGGATTC ATGTTGAATATGCAAGAAAAGCACTTCAGATTGTTGATTCATCGCCAGAGATGGCTTAGAACCAATAGTTCATTATCTAATGGATTTTTCTGTTCTAATACTCCATTCGAGAGAACACTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAGATGGCTTTCCCTAGATGAAATGAAAATTGGATTC MLNMQEKHFRLLIHRQRWLRTNSSLSNGFFCSNTPFERTLLDQMTKTLLRKRWLSLDEMKIGF Homology
BLAST of CcUC02G028150 vs. NCBI nr
Match: YP_009751528.1 (Ycf2 protein [Thladiantha dubia] >YP_009751546.1 Ycf2 protein [Thladiantha dubia] >QIT04009.1 Ycf2 protein [Thladiantha dubia] >QIT04027.1 Ycf2 protein [Thladiantha dubia]) HSP 1 Score: 103.2 bits (256), Expect = 8.3e-19 Identity = 55/73 (75.34%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. NCBI nr
Match: YP_009262354.1 (hypothetical chloroplast RF2 [Spondias tuberosa] >ANI86805.1 hypothetical chloroplast RF2 [Spondias tuberosa]) HSP 1 Score: 102.4 bits (254), Expect = 1.4e-18 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. NCBI nr
Match: YP_009262268.1 (hypothetical chloroplast RF2 [Spondias bahiensis] >ANI86719.1 hypothetical chloroplast RF2 [Spondias bahiensis]) HSP 1 Score: 102.4 bits (254), Expect = 1.4e-18 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. NCBI nr
Match: YP_009262247.1 (hypothetical chloroplast RF2 [Spondias bahiensis] >ANI86720.1 hypothetical chloroplast RF2 [Spondias bahiensis]) HSP 1 Score: 102.4 bits (254), Expect = 1.4e-18 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. NCBI nr
Match: YP_009431516.1 (hypothetical chloroplast RF2 [Spondias mombin] >YP_009431534.1 hypothetical chloroplast RF2 [Spondias mombin] >ASY95753.1 hypothetical chloroplast RF2 [Spondias mombin] >ASY95754.1 hypothetical chloroplast RF2 [Spondias mombin]) HSP 1 Score: 102.4 bits (254), Expect = 1.4e-18 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy Swiss-Prot
Match: B1A978 (Protein Ycf2 OS=Carica papaya OX=3649 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 7.1e-21 Identity = 54/73 (73.97%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy Swiss-Prot
Match: Q09MB4 (Protein Ycf2 OS=Citrus sinensis OX=2711 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 7.1e-21 Identity = 54/73 (73.97%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy Swiss-Prot
Match: Q49KT6 (Protein Ycf2 OS=Eucalyptus globulus subsp. globulus OX=71271 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 3.5e-20 Identity = 53/73 (72.60%), Postives = 53/73 (72.60%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy Swiss-Prot
Match: Q0ZIV6 (Protein Ycf2 OS=Vitis vinifera OX=29760 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.0e-19 Identity = 52/73 (71.23%), Postives = 52/73 (71.23%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy Swiss-Prot
Match: A6MM80 (Protein Ycf2 OS=Buxus microphylla OX=153571 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 8.6e-19 Identity = 52/73 (71.23%), Postives = 52/73 (71.23%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy TrEMBL
Match: A0A6H0ER44 (Protein Ycf2 OS=Thladiantha dubia OX=210344 GN=ycf2 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 4.0e-19 Identity = 55/73 (75.34%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy TrEMBL
Match: A0A249RWP1 (Protein Ycf2 OS=Spondias mombin OX=80338 GN=ycf2 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 6.9e-19 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy TrEMBL
Match: A0A191TDN4 (Protein Ycf2 OS=Spondias bahiensis OX=1577648 GN=ycf2 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 6.9e-19 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy TrEMBL
Match: A0A191TDM6 (Protein Ycf2 OS=Spondias bahiensis OX=1577648 GN=ycf2 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 6.9e-19 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. ExPASy TrEMBL
Match: A0A191TDW0 (Protein Ycf2 OS=Spondias tuberosa OX=991123 GN=ycf2 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 6.9e-19 Identity = 54/73 (73.97%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CcUC02G028150 vs. TAIR 10
Match: ATCG00860.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 91.7 bits (226), Expect = 2.3e-19 Identity = 50/73 (68.49%), Postives = 52/73 (71.23%), Query Frame = 0
BLAST of CcUC02G028150 vs. TAIR 10
Match: ATCG01280.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 91.7 bits (226), Expect = 2.3e-19 Identity = 50/73 (68.49%), Postives = 52/73 (71.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|