
CcUC02G023660 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATAGAAAGAAAATGAGACCCAAAAGAGCCCCTTCTTTTACCATTTTAGCGGGTGGAGGTGAAGGGGGGTTTACATACAACCGAGGCAAAGTGGTTTATGATTAAATCTAAGAAGCATTCTTATCATTTGGTAGATCCAAGTCCATGGCCCATTTCGGGTTCACTCGGAGCTTTGGCAACCACCGTAGGAGGTGTGATGTACATGCACTCATTTCAAGGGGTGCAACACTTCTAAGTTTGGGCTTCATATTTATCCTATATACCATGTTCGTATGGTGGCTCGATGTTCTACGTGAATCTTTCAATTGGTTAGAATTCGTTACT ATAGAAAGAAAATGAGACCCAAAAGAGCCCCTTCTTTTACCATTTTAGCGGGTGGAGGTGAAGGGGGATCCAAGTCCATGGCCCATTTCGGGTTCACTCGGAGCTTTGGCAACCACCGTAGGAGGTGTGATGTACATGCACTCATTTCAAGGGGTGCAACACTTCTAAGTTTGGGCTTCATATTTATCCTATATACCATGTTCGTATGGTGGCTCGATGTTCTACGTGAATCTTTCAATTGGTTAGAATTCGTTACT ATGAGACCCAAAAGAGCCCCTTCTTTTACCATTTTAGCGGGTGGAGGTGAAGGGGGATCCAAGTCCATGGCCCATTTCGGGTTCACTCGGAGCTTTGGCAACCACCGTAGGAGGTGTGATGTACATGCACTCATTTCAAGGGGTGCAACACTTCTAAGTTTGGGCTTCATATTTATCCTATATACCATGTTCGTATGGTGGCTCGATGTTCTACGTGAATCTTTCAATTGGTTAGAATTCGTTACT MRPKRAPSFTILAGGGEGGSKSMAHFGFTRSFGNHRRRCDVHALISRGATLLSLGFIFILYTMFVWWLDVLRESFNWLEFVT Homology
BLAST of CcUC02G023660 vs. NCBI nr
Match: GFP95426.1 (cytochrome c oxidase subunit 3 [Phtheirospermum japonicum]) HSP 1 Score: 100.5 bits (249), Expect = 7.0e-18 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 0
BLAST of CcUC02G023660 vs. NCBI nr
Match: PUZ39219.1 (hypothetical protein GQ55_9G268800 [Panicum hallii var. hallii]) HSP 1 Score: 99.4 bits (246), Expect = 1.6e-17 Identity = 47/52 (90.38%), Postives = 49/52 (94.23%), Query Frame = 0
BLAST of CcUC02G023660 vs. NCBI nr
Match: VDD26767.1 (unnamed protein product [Brassica rapa]) HSP 1 Score: 97.4 bits (241), Expect = 5.9e-17 Identity = 46/52 (88.46%), Postives = 48/52 (92.31%), Query Frame = 0
BLAST of CcUC02G023660 vs. NCBI nr
Match: YP_009315972.1 (cytochrome oxidase subunit 3 [Cocos nucifera] >AOX12966.1 cytochrome oxidase subunit 3 [Cocos nucifera]) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-07 Identity = 45/100 (45.00%), Postives = 48/100 (48.00%), Query Frame = 0
BLAST of CcUC02G023660 vs. NCBI nr
Match: KAG6604293.1 (Cytochrome c oxidase subunit 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 62.8 bits (151), Expect = 1.6e-06 Identity = 31/49 (63.27%), Postives = 32/49 (65.31%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy Swiss-Prot
Match: P32808 (Cytochrome c oxidase subunit 3 OS=Helianthus annuus OX=4232 GN=COX3 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-06 Identity = 25/27 (92.59%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy Swiss-Prot
Match: P14853 (Cytochrome c oxidase subunit 3 OS=Glycine max OX=3847 GN=COX3 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-06 Identity = 25/27 (92.59%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy Swiss-Prot
Match: Q03227 (Cytochrome c oxidase subunit 3 OS=Vicia faba OX=3906 GN=COX3 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-06 Identity = 25/27 (92.59%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy Swiss-Prot
Match: P15953 (Cytochrome c oxidase subunit 3 OS=Triticum aestivum OX=4565 GN=COX3 PE=2 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-06 Identity = 25/27 (92.59%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy Swiss-Prot
Match: Q36952 (Cytochrome c oxidase subunit 3 OS=Aegilops columnaris OX=4493 GN=COX3 PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.7e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy TrEMBL
Match: A0A2T7C796 (Cytochrome c oxidase subunit 3 OS=Panicum hallii var. hallii OX=1504633 GN=GQ55_9G268800 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 7.5e-18 Identity = 47/52 (90.38%), Postives = 49/52 (94.23%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy TrEMBL
Match: A0A3P6D6P0 (Cytochrome c oxidase subunit 3 OS=Brassica campestris OX=3711 GN=BRASC177T45751Z PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 2.9e-17 Identity = 46/52 (88.46%), Postives = 48/52 (92.31%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy TrEMBL
Match: A0A2Z2CD33 (Cytochrome c oxidase subunit 3 OS=Cocos nucifera OX=13894 GN=cox3 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 7.1e-08 Identity = 45/100 (45.00%), Postives = 48/100 (48.00%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy TrEMBL
Match: A0A4D8YNU3 (Mitochondrial protein YMF19 OS=Salvia splendens OX=180675 GN=ATPF0B PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 2.1e-07 Identity = 31/45 (68.89%), Postives = 34/45 (75.56%), Query Frame = 0
BLAST of CcUC02G023660 vs. ExPASy TrEMBL
Match: Q1KZN6 (Cytochrome c oxidase subunit 3 (Fragment) OS=Sambucus nigra subsp. canadensis OX=57008 GN=cox3 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 2.3e-06 Identity = 31/44 (70.45%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CcUC02G023660 vs. TAIR 10
Match: AT2G07687.1 (Cytochrome c oxidase, subunit III ) HSP 1 Score: 50.4 bits (119), Expect = 7.7e-07 Identity = 24/27 (88.89%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of CcUC02G023660 vs. TAIR 10
Match: ATMG00730.1 (cytochrome c oxidase subunit 3 ) HSP 1 Score: 50.4 bits (119), Expect = 7.7e-07 Identity = 24/27 (88.89%), Postives = 24/27 (88.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|