Carg24175 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAATAAGCCTTTGGGATCGACTGGAGAGTTCTTCAGGAGGACAGACGAGTGGAGGAAGCATCCGATGCTCTCCAATCAGTTCCGACATGCCACTCCTGGCCTCGGCATCGCTCTCGTTGCTTTCGGCATCTACCTTGTCGGCGAGCAAGTATATAACAGGATCCATTCTCCTTCTTCCTCTCGCCATCACCATGCTGATGCTTCCTCCGCCACCCATTAA ATGGCGAATAAGCCTTTGGGATCGACTGGAGAGTTCTTCAGGAGGACAGACGAGTGGAGGAAGCATCCGATGCTCTCCAATCAGTTCCGACATGCCACTCCTGGCCTCGGCATCGCTCTCGTTGCTTTCGGCATCTACCTTGTCGGCGAGCAAGTATATAACAGGATCCATTCTCCTTCTTCCTCTCGCCATCACCATGCTGATGCTTCCTCCGCCACCCATTAA ATGGCGAATAAGCCTTTGGGATCGACTGGAGAGTTCTTCAGGAGGACAGACGAGTGGAGGAAGCATCCGATGCTCTCCAATCAGTTCCGACATGCCACTCCTGGCCTCGGCATCGCTCTCGTTGCTTTCGGCATCTACCTTGTCGGCGAGCAAGTATATAACAGGATCCATTCTCCTTCTTCCTCTCGCCATCACCATGCTGATGCTTCCTCCGCCACCCATTAA MANKPLGSTGEFFRRTDEWRKHPMLSNQFRHATPGLGIALVAFGIYLVGEQVYNRIHSPSSSRHHHADASSATH Homology
BLAST of Carg24175 vs. NCBI nr
Match: KAG7028500.1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 157.1 bits (396), Expect = 5.7e-35 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of Carg24175 vs. NCBI nr
Match: XP_022950932.1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B-like [Cucurbita moschata]) HSP 1 Score: 155.2 bits (391), Expect = 2.2e-34 Identity = 73/74 (98.65%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of Carg24175 vs. NCBI nr
Match: XP_022974255.1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B-like [Cucurbita maxima]) HSP 1 Score: 154.1 bits (388), Expect = 4.8e-34 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of Carg24175 vs. NCBI nr
Match: XP_023540348.1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 150.2 bits (378), Expect = 7.0e-33 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Carg24175 vs. NCBI nr
Match: XP_008460580.1 (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B [Cucumis melo] >XP_008460581.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B [Cucumis melo]) HSP 1 Score: 147.9 bits (372), Expect = 3.4e-32 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of Carg24175 vs. ExPASy Swiss-Prot
Match: Q9M9R9 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B OS=Arabidopsis thaliana OX=3702 GN=At1g14450 PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 6.1e-24 Identity = 48/71 (67.61%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of Carg24175 vs. ExPASy Swiss-Prot
Match: O64725 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-A OS=Arabidopsis thaliana OX=3702 GN=At2g02510 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.4e-20 Identity = 43/62 (69.35%), Postives = 52/62 (83.87%), Query Frame = 0
BLAST of Carg24175 vs. ExPASy TrEMBL
Match: A0A6J1GG90 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B-like OS=Cucurbita moschata OX=3662 GN=LOC111453875 PE=3 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 1.0e-34 Identity = 73/74 (98.65%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of Carg24175 vs. ExPASy TrEMBL
Match: A0A6J1IDH2 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B-like OS=Cucurbita maxima OX=3661 GN=LOC111472888 PE=3 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 2.3e-34 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of Carg24175 vs. ExPASy TrEMBL
Match: A0A1S3CD83 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B OS=Cucumis melo OX=3656 GN=LOC103499369 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 1.7e-32 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of Carg24175 vs. ExPASy TrEMBL
Match: A0A6J1KDK9 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B-like OS=Cucurbita maxima OX=3661 GN=LOC111493369 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 2.8e-32 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of Carg24175 vs. ExPASy TrEMBL
Match: A0A0A0KR92 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G528700 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 2.8e-32 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of Carg24175 vs. TAIR 10
Match: AT1G14450.1 (NADH dehydrogenase (ubiquinone)s ) HSP 1 Score: 110.9 bits (276), Expect = 4.4e-25 Identity = 48/71 (67.61%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of Carg24175 vs. TAIR 10
Match: AT2G02510.1 (NADH dehydrogenase (ubiquinone)s ) HSP 1 Score: 99.8 bits (247), Expect = 1.0e-21 Identity = 43/62 (69.35%), Postives = 52/62 (83.87%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|