
Carg22387 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGACCACGATGATCAAGTTTTTAGCGTCGTTGCTTTTTAGCCTGTTTCTGGTTGGTACTATTGCCACTCCCTTGTGTCGAGTCGACACGAAGGAGCTCAAGATGTGCCAGCCAGCGGTTGCACCACCACACGGGCAGCTGCTGCAACCACCGACCAAAGGCTGCTGTTCGGTCGTCCGACGTGCAGACCTCAAGTGCCTATGTAGTCTCAAGTCTGTCCTCCCTACCATCGGGATTAACACAGCCAATGCCTTGGCTCTGCCTTCCAAATGTGGCATTCATACTCCCCCCGAGTGCCATGGTTAG ATGGCGACCACGATGATCAAGTTTTTAGCGTCGTTGCTTTTTAGCCTGTTTCTGGTTGGTACTATTGCCACTCCCTTGTGTCGAGTCGACACGAAGGAGCTCAAGATGTGCCAGCCAGCGGTTGCACCACCACACGGGCAGCTGCTGCAACCACCGACCAAAGGCTGCTGTTCGGTCGTCCGACGTGCAGACCTCAAGTGCCTATGTAGTCTCAAGTCTGTCCTCCCTACCATCGGGATTAACACAGCCAATGCCTTGGCTCTGCCTTCCAAATGTGGCATTCATACTCCCCCCGAGTGCCATGGTTAG ATGGCGACCACGATGATCAAGTTTTTAGCGTCGTTGCTTTTTAGCCTGTTTCTGGTTGGTACTATTGCCACTCCCTTGTGTCGAGTCGACACGAAGGAGCTCAAGATGTGCCAGCCAGCGGTTGCACCACCACACGGGCAGCTGCTGCAACCACCGACCAAAGGCTGCTGTTCGGTCGTCCGACGTGCAGACCTCAAGTGCCTATGTAGTCTCAAGTCTGTCCTCCCTACCATCGGGATTAACACAGCCAATGCCTTGGCTCTGCCTTCCAAATGTGGCATTCATACTCCCCCCGAGTGCCATGGTTAG MATTMIKFLASLLFSLFLVGTIATPLCRVDTKELKMCQPAVAPPHGQLLQPPTKGCCSVVRRADLKCLCSLKSVLPTIGINTANALALPSKCGIHTPPECHG Homology
BLAST of Carg22387 vs. NCBI nr
Match: KAG7037350.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 209.1 bits (531), Expect = 1.7e-50 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of Carg22387 vs. NCBI nr
Match: KAG6607773.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 196.4 bits (498), Expect = 1.2e-46 Identity = 96/98 (97.96%), Postives = 96/98 (97.96%), Query Frame = 0
BLAST of Carg22387 vs. NCBI nr
Match: XP_038896217.1 (putative lipid-transfer protein DIR1 [Benincasa hispida]) HSP 1 Score: 138.3 bits (347), Expect = 3.8e-29 Identity = 67/96 (69.79%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of Carg22387 vs. NCBI nr
Match: KAA0048160.1 (putative lipid-transfer protein DIR1 [Cucumis melo var. makuwa]) HSP 1 Score: 131.0 bits (328), Expect = 6.0e-27 Identity = 62/85 (72.94%), Postives = 71/85 (83.53%), Query Frame = 0
BLAST of Carg22387 vs. NCBI nr
Match: KAG7037349.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 127.1 bits (318), Expect = 8.7e-26 Identity = 59/96 (61.46%), Postives = 76/96 (79.17%), Query Frame = 0
BLAST of Carg22387 vs. ExPASy TrEMBL
Match: A0A5A7TY68 (Putative lipid-transfer protein DIR1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold63G00600 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.9e-27 Identity = 62/85 (72.94%), Postives = 71/85 (83.53%), Query Frame = 0
BLAST of Carg22387 vs. ExPASy TrEMBL
Match: A0A0A0LBB0 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G759990 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 1.1e-26 Identity = 63/95 (66.32%), Postives = 74/95 (77.89%), Query Frame = 0
BLAST of Carg22387 vs. ExPASy TrEMBL
Match: A0A0A0LAS6 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G760500 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 1.2e-25 Identity = 62/102 (60.78%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Carg22387 vs. ExPASy TrEMBL
Match: A0A5A7TX28 (Putative lipid-transfer protein DIR1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold63G00630 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 6.1e-25 Identity = 61/101 (60.40%), Postives = 73/101 (72.28%), Query Frame = 0
BLAST of Carg22387 vs. ExPASy TrEMBL
Match: A0A1S3BHE7 (putative lipid-transfer protein DIR1 OS=Cucumis melo OX=3656 GN=LOC103490109 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 6.1e-25 Identity = 61/101 (60.40%), Postives = 73/101 (72.28%), Query Frame = 0
BLAST of Carg22387 vs. TAIR 10
Match: AT5G55450.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 67.0 bits (162), Expect = 9.9e-12 Identity = 35/90 (38.89%), Postives = 53/90 (58.89%), Query Frame = 0
BLAST of Carg22387 vs. TAIR 10
Match: AT5G55410.2 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-11 Identity = 33/96 (34.38%), Postives = 53/96 (55.21%), Query Frame = 0
BLAST of Carg22387 vs. TAIR 10
Match: AT5G55410.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 64.3 bits (155), Expect = 6.4e-11 Identity = 31/91 (34.07%), Postives = 51/91 (56.04%), Query Frame = 0
BLAST of Carg22387 vs. TAIR 10
Match: AT5G55460.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 62.4 bits (150), Expect = 2.4e-10 Identity = 39/102 (38.24%), Postives = 57/102 (55.88%), Query Frame = 0
BLAST of Carg22387 vs. TAIR 10
Match: AT3G52130.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 45.8 bits (107), Expect = 2.4e-05 Identity = 27/66 (40.91%), Postives = 35/66 (53.03%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|