Carg16059 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGCTGATCAAAACCGTCCTCAAACTCGACATTTCTTGTCAAAAATGCAAGACCAAAGTCCTCAAAGCTGTTACTAGTCTCGAAGGTAGCTCTTTCTCTTTAGTATTAATGGATATATTTTCGTGAATAATTGAGTTTTATTCTCAGTGAATTATTTTTCTGTGTAGACGTGGATAAGGTCGAGACGGATGAAGCGAAAGGGACGATCGGCGTGATTGGGAAGGCGGATCCGTACAAGATAGTTAAAATTACGAGGAAGGCGGTTTCCTCCGCCGGCAAGGTTGTCGAGGTGGTGAGCATTGGACCGCCGCCCAAACCCGACGAGAAGAAGCCGGAGGAGAAGAAACCCGATGGTAAGAAGCCCGACCCGGTACCATGCATATGCGCATGTCCTCCCTACCCGCCTTATGGATCGTCGTACATAGTCGTGCCTCATGAAACCCAACCTTCTTGTTCTATCCTTTAA ATGGCGCTGATCAAAACCGTCCTCAAACTCGACATTTCTTGTCAAAAATGCAAGACCAAAGTCCTCAAAGCTGTTACTAGTCTCGAAGACGTGGATAAGGTCGAGACGGATGAAGCGAAAGGGACGATCGGCGTGATTGGGAAGGCGGATCCGTACAAGATAGTTAAAATTACGAGGAAGGCGGTTTCCTCCGCCGGCAAGGTTGTCGAGGTGGTGAGCATTGGACCGCCGCCCAAACCCGACGAGAAGAAGCCGGAGGAGAAGAAACCCGATGGTAAGAAGCCCGACCCGGTACCATGCATATGCGCATGTCCTCCCTACCCGCCTTATGGATCGTCGTACATAGTCGTGCCTCATGAAACCCAACCTTCTTGTTCTATCCTTTAA ATGGCGCTGATCAAAACCGTCCTCAAACTCGACATTTCTTGTCAAAAATGCAAGACCAAAGTCCTCAAAGCTGTTACTAGTCTCGAAGACGTGGATAAGGTCGAGACGGATGAAGCGAAAGGGACGATCGGCGTGATTGGGAAGGCGGATCCGTACAAGATAGTTAAAATTACGAGGAAGGCGGTTTCCTCCGCCGGCAAGGTTGTCGAGGTGGTGAGCATTGGACCGCCGCCCAAACCCGACGAGAAGAAGCCGGAGGAGAAGAAACCCGATGGTAAGAAGCCCGACCCGGTACCATGCATATGCGCATGTCCTCCCTACCCGCCTTATGGATCGTCGTACATAGTCGTGCCTCATGAAACCCAACCTTCTTGTTCTATCCTTTAA MALIKTVLKLDISCQKCKTKVLKAVTSLEDVDKVETDEAKGTIGVIGKADPYKIVKITRKAVSSAGKVVEVVSIGPPPKPDEKKPEEKKPDGKKPDPVPCICACPPYPPYGSSYIVVPHETQPSCSIL Homology
BLAST of Carg16059 vs. NCBI nr
Match: KAG7026779.1 (hypothetical protein SDJN02_10786, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 250.4 bits (638), Expect = 8.5e-63 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg16059 vs. NCBI nr
Match: XP_023518146.1 (heavy metal-associated isoprenylated plant protein 43-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 246.1 bits (627), Expect = 1.6e-61 Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 0
BLAST of Carg16059 vs. NCBI nr
Match: XP_022962785.1 (heavy metal-associated isoprenylated plant protein 43-like [Cucurbita moschata]) HSP 1 Score: 245.0 bits (624), Expect = 3.6e-61 Identity = 125/128 (97.66%), Postives = 126/128 (98.44%), Query Frame = 0
BLAST of Carg16059 vs. NCBI nr
Match: XP_023003318.1 (heavy metal-associated isoprenylated plant protein 43-like [Cucurbita maxima]) HSP 1 Score: 229.2 bits (583), Expect = 2.0e-56 Identity = 120/128 (93.75%), Postives = 122/128 (95.31%), Query Frame = 0
BLAST of Carg16059 vs. NCBI nr
Match: XP_038877711.1 (heavy metal-associated isoprenylated plant protein 43-like [Benincasa hispida]) HSP 1 Score: 195.3 bits (495), Expect = 3.3e-46 Identity = 99/128 (77.34%), Postives = 109/128 (85.16%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy Swiss-Prot
Match: Q9SFF7 (Heavy metal-associated isoprenylated plant protein 43 OS=Arabidopsis thaliana OX=3702 GN=HIPP43 PE=2 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.5e-09 Identity = 47/135 (34.81%), Postives = 72/135 (53.33%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy Swiss-Prot
Match: Q9LTE3 (Heavy metal-associated isoprenylated plant protein 12 OS=Arabidopsis thaliana OX=3702 GN=HIPP12 PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.8e-08 Identity = 45/120 (37.50%), Postives = 66/120 (55.00%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy Swiss-Prot
Match: Q8GWS3 (Heavy metal-associated isoprenylated plant protein 2 OS=Arabidopsis thaliana OX=3702 GN=HIPP02 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 2.4e-07 Identity = 45/128 (35.16%), Postives = 64/128 (50.00%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy Swiss-Prot
Match: O03982 (Heavy metal-associated isoprenylated plant protein 39 OS=Arabidopsis thaliana OX=3702 GN=HIPP39 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.4e-04 Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy Swiss-Prot
Match: Q9FJH5 (Heavy metal-associated isoprenylated plant protein 3 OS=Arabidopsis thaliana OX=3702 GN=HIPP03 PE=1 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.4e-04 Identity = 42/115 (36.52%), Postives = 59/115 (51.30%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy TrEMBL
Match: A0A6J1HG22 (heavy metal-associated isoprenylated plant protein 43-like OS=Cucurbita moschata OX=3662 GN=LOC111463168 PE=4 SV=1) HSP 1 Score: 245.0 bits (624), Expect = 1.7e-61 Identity = 125/128 (97.66%), Postives = 126/128 (98.44%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy TrEMBL
Match: A0A6J1KW59 (heavy metal-associated isoprenylated plant protein 43-like OS=Cucurbita maxima OX=3661 GN=LOC111496961 PE=4 SV=1) HSP 1 Score: 229.2 bits (583), Expect = 9.9e-57 Identity = 120/128 (93.75%), Postives = 122/128 (95.31%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy TrEMBL
Match: A0A0A0KJ75 (HMA domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G504410 PE=4 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 7.3e-44 Identity = 100/136 (73.53%), Postives = 113/136 (83.09%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy TrEMBL
Match: A0A1S3B1X1 (heavy metal-associated isoprenylated plant protein 3-like OS=Cucumis melo OX=3656 GN=LOC103485075 PE=4 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 8.4e-40 Identity = 94/137 (68.61%), Postives = 108/137 (78.83%), Query Frame = 0
BLAST of Carg16059 vs. ExPASy TrEMBL
Match: A0A6J1GFG8 (heavy metal-associated isoprenylated plant protein 43-like OS=Cucurbita moschata OX=3662 GN=LOC111453697 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 4.0e-34 Identity = 82/129 (63.57%), Postives = 96/129 (74.42%), Query Frame = 0
BLAST of Carg16059 vs. TAIR 10
Match: AT3G05920.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-10 Identity = 47/135 (34.81%), Postives = 72/135 (53.33%), Query Frame = 0
BLAST of Carg16059 vs. TAIR 10
Match: AT5G52740.1 (Copper transport protein family ) HSP 1 Score: 59.7 bits (143), Expect = 2.0e-09 Identity = 45/120 (37.50%), Postives = 66/120 (55.00%), Query Frame = 0
BLAST of Carg16059 vs. TAIR 10
Match: AT5G26690.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 56.6 bits (135), Expect = 1.7e-08 Identity = 45/128 (35.16%), Postives = 64/128 (50.00%), Query Frame = 0
BLAST of Carg16059 vs. TAIR 10
Match: AT1G01490.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-05 Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 0
BLAST of Carg16059 vs. TAIR 10
Match: AT1G01490.2 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-05 Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|