Carg15867 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAGTTTGGCATCACAGTTGTTTGCTTTTTCATGGTGGCGTTTCTCACCGGAGCCCATCACGTAGGCGCACAGCAGACGTGCGACCCTCAGCTGCTAGCCATTCCATGTGGACTTGCATTCTCTGGCATGAGACCGTCTACCCGATGCTGCAATAAGCTGAGGGAGCAACAGCCATGCTACTGTGCATACCTCAATAATCCAGATTTGAAGGGTTTTGTGGACTCTCCTGCCGCGAGAAGGATTGCTAGAGACTGCAACATTACGATCCCAACTCAGGCCGAGTGCCCTGCAAGCCCTGCTTAG ATGAAGAAGTTTGGCATCACAGTTGTTTGCTTTTTCATGGTGGCGTTTCTCACCGGAGCCCATCACGTAGGCGCACAGCAGACGTGCGACCCTCAGCTGCTAGCCATTCCATGTGGACTTGCATTCTCTGGCATGAGACCGTCTACCCGATGCTGCAATAAGCTGAGGGAGCAACAGCCATGCTACTGTGCATACCTCAATAATCCAGATTTGAAGGGTTTTGTGGACTCTCCTGCCGCGAGAAGGATTGCTAGAGACTGCAACATTACGATCCCAACTCAGGCCGAGTGCCCTGCAAGCCCTGCTTAG ATGAAGAAGTTTGGCATCACAGTTGTTTGCTTTTTCATGGTGGCGTTTCTCACCGGAGCCCATCACGTAGGCGCACAGCAGACGTGCGACCCTCAGCTGCTAGCCATTCCATGTGGACTTGCATTCTCTGGCATGAGACCGTCTACCCGATGCTGCAATAAGCTGAGGGAGCAACAGCCATGCTACTGTGCATACCTCAATAATCCAGATTTGAAGGGTTTTGTGGACTCTCCTGCCGCGAGAAGGATTGCTAGAGACTGCAACATTACGATCCCAACTCAGGCCGAGTGCCCTGCAAGCCCTGCTTAG MKKFGITVVCFFMVAFLTGAHHVGAQQTCDPQLLAIPCGLAFSGMRPSTRCCNKLREQQPCYCAYLNNPDLKGFVDSPAARRIARDCNITIPTQAECPASPA Homology
BLAST of Carg15867 vs. NCBI nr
Match: KAG7026200.1 (hypothetical protein SDJN02_12699, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 221.1 bits (562), Expect = 4.4e-54 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of Carg15867 vs. NCBI nr
Match: KAG6581747.1 (hypothetical protein SDJN03_21749, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 219.5 bits (558), Expect = 1.3e-53 Identity = 101/102 (99.02%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of Carg15867 vs. NCBI nr
Match: KAE8648021.1 (hypothetical protein Csa_005848 [Cucumis sativus]) HSP 1 Score: 119.8 bits (299), Expect = 1.4e-23 Identity = 61/102 (59.80%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of Carg15867 vs. NCBI nr
Match: KAE8649342.1 (hypothetical protein Csa_014385 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 2.6e-22 Identity = 59/99 (59.60%), Postives = 70/99 (70.71%), Query Frame = 0
BLAST of Carg15867 vs. NCBI nr
Match: XP_008444079.1 (PREDICTED: non-specific lipid-transfer protein 2P-like [Cucumis melo] >KAA0064163.1 non-specific lipid-transfer protein 2P-like [Cucumis melo var. makuwa] >TYK02866.1 non-specific lipid-transfer protein 2P-like [Cucumis melo var. makuwa]) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-17 Identity = 54/104 (51.92%), Postives = 64/104 (61.54%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.3e-13 Identity = 35/92 (38.04%), Postives = 53/92 (57.61%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-12 Identity = 31/65 (47.69%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy Swiss-Prot
Match: P20145 (Probable non-specific lipid-transfer protein OS=Hordeum vulgare OX=4513 GN=LTP2 PE=2 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.7e-11 Identity = 33/92 (35.87%), Postives = 42/92 (45.65%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 8.2e-11 Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy Swiss-Prot
Match: P82901 (Non-specific lipid-transfer protein 2P OS=Triticum aestivum OX=4565 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.9e-09 Identity = 24/64 (37.50%), Postives = 33/64 (51.56%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy TrEMBL
Match: A0A0A0KZL4 (Putative lipid transfer protein family protein OS=Cucumis sativus OX=3659 GN=Csa_4G146240 PE=4 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 6.7e-24 Identity = 61/102 (59.80%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy TrEMBL
Match: A0A5A7V7R4 (Non-specific lipid-transfer protein 2P-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold218G00730 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 5.5e-18 Identity = 54/104 (51.92%), Postives = 64/104 (61.54%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy TrEMBL
Match: A0A1S3BAC3 (non-specific lipid-transfer protein 2P-like OS=Cucumis melo OX=3656 GN=LOC103487519 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 5.5e-18 Identity = 54/104 (51.92%), Postives = 64/104 (61.54%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy TrEMBL
Match: A0A6J1GTR0 (non-specific lipid-transfer protein 2-like OS=Cucurbita moschata OX=3662 GN=LOC111457455 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 1.3e-14 Identity = 44/96 (45.83%), Postives = 56/96 (58.33%), Query Frame = 0
BLAST of Carg15867 vs. ExPASy TrEMBL
Match: A0A103Y098 (Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain-containing protein OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_021620 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 3.7e-14 Identity = 39/92 (42.39%), Postives = 56/92 (60.87%), Query Frame = 0
BLAST of Carg15867 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-13 Identity = 31/66 (46.97%), Postives = 38/66 (57.58%), Query Frame = 0
BLAST of Carg15867 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 72.4 bits (176), Expect = 2.4e-13 Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of Carg15867 vs. TAIR 10
Match: AT1G73780.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 3.4e-12 Identity = 34/89 (38.20%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of Carg15867 vs. TAIR 10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 4.9e-11 Identity = 27/69 (39.13%), Postives = 38/69 (55.07%), Query Frame = 0
BLAST of Carg15867 vs. TAIR 10
Match: AT5G38160.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 61.2 bits (147), Expect = 5.5e-10 Identity = 26/66 (39.39%), Postives = 35/66 (53.03%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|