
CaUC05G096790 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATGAACACCACCAATCACAGCCACCGTCCTCGCCGTCACCGCCGCTCCCTGGAGGTGGAAGAAAAGATTCAGCGAAACAAGAAGAAGAAGAAGAAGTCAATCCAGAAACCAAATCCAAATCTACAGTCCGGTGTAAGAACAACACCTTTTTCGGCAGACATAGAATCTCAGCAGCCATAACTAGACTCCAAATTGAAATCAATATCATCAAGGTAATCGCTATTTCATTTTACGATTCACAGATTTACCTTAATCGCCATCGCTCTGATGATAAATCGTAATGATGCAGGAAGAATTGCAACAGCTCGAGAACATAGGTGAAGCCTCTACAGTCTGCGCAGGGTAAGAAGATTAATCAAATTCATTAGGGTTTCAAAATTCTTCAAATCGTTTAGAATCATCGTCTCCACTTCTCTAGGGCTTAATTTTCTTTCTTTACCTATTTACGTACAGATTCGTCTCCAGCGTTGAATCGATTCCAGATCCTTTGCTTCCAGAGTAAGATTATATCGCCATTAACAATAGCTATCGATCTTAGAATATAAATGAGAATTTCTTGGCCTAATCAACGAAGAATCGTTGAAAATACACAGAACAATCGGTCCGACGGACGTGAACTGGGACCAGTGGTTCCGAGGAGCTCACGGCGGCCGCAACCACAGACGGTGGATCTGA ATGGCTGATGAACACCACCAATCACAGCCACCGTCCTCGCCGTCACCGCCGCTCCCTGGAGGTGGAAGAAAAGATTCAGCGAAACAAGAAGAAGAAGAAGAAGTCAATCCAGAAACCAAATCCAAATCTACAGTCCGGTGTAAGAACAACACCTTTTTCGGCAGACATAGAATCTCAGCAGCCATAACTAGACTCCAAATTGAAATCAATATCATCAAGGAAGAATTGCAACAGCTCGAGAACATAGGTGAAGCCTCTACAGTCTGCGCAGGATTCGTCTCCAGCGTTGAATCGATTCCAGATCCTTTGCTTCCAGAAACAATCGGTCCGACGGACGTGAACTGGGACCAGTGGTTCCGAGGAGCTCACGGCGGCCGCAACCACAGACGGTGGATCTGA ATGGCTGATGAACACCACCAATCACAGCCACCGTCCTCGCCGTCACCGCCGCTCCCTGGAGGTGGAAGAAAAGATTCAGCGAAACAAGAAGAAGAAGAAGAAGTCAATCCAGAAACCAAATCCAAATCTACAGTCCGGTGTAAGAACAACACCTTTTTCGGCAGACATAGAATCTCAGCAGCCATAACTAGACTCCAAATTGAAATCAATATCATCAAGGAAGAATTGCAACAGCTCGAGAACATAGGTGAAGCCTCTACAGTCTGCGCAGGATTCGTCTCCAGCGTTGAATCGATTCCAGATCCTTTGCTTCCAGAAACAATCGGTCCGACGGACGTGAACTGGGACCAGTGGTTCCGAGGAGCTCACGGCGGCCGCAACCACAGACGGTGGATCTGA MADEHHQSQPPSSPSPPLPGGGRKDSAKQEEEEEVNPETKSKSTVRCKNNTFFGRHRISAAITRLQIEINIIKEELQQLENIGEASTVCAGFVSSVESIPDPLLPETIGPTDVNWDQWFRGAHGGRNHRRWI Homology
BLAST of CaUC05G096790 vs. NCBI nr
Match: XP_038897196.1 (guanine nucleotide-binding protein subunit gamma 2-like [Benincasa hispida]) HSP 1 Score: 229.6 bits (584), Expect = 1.6e-56 Identity = 115/132 (87.12%), Postives = 120/132 (90.91%), Query Frame = 0
BLAST of CaUC05G096790 vs. NCBI nr
Match: XP_008466337.1 (PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cucumis melo]) HSP 1 Score: 210.7 bits (535), Expect = 7.7e-51 Identity = 110/133 (82.71%), Postives = 117/133 (87.97%), Query Frame = 0
BLAST of CaUC05G096790 vs. NCBI nr
Match: XP_004136323.1 (guanine nucleotide-binding protein subunit gamma 2 [Cucumis sativus] >KGN60151.1 hypothetical protein Csa_002404 [Cucumis sativus]) HSP 1 Score: 209.1 bits (531), Expect = 2.2e-50 Identity = 109/133 (81.95%), Postives = 114/133 (85.71%), Query Frame = 0
BLAST of CaUC05G096790 vs. NCBI nr
Match: KAG7024498.1 (Guanine nucleotide-binding protein subunit gamma 1 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 192.2 bits (487), Expect = 2.8e-45 Identity = 102/130 (78.46%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of CaUC05G096790 vs. NCBI nr
Match: XP_022937378.1 (guanine nucleotide-binding protein subunit gamma 2-like [Cucurbita moschata]) HSP 1 Score: 189.9 bits (481), Expect = 1.4e-44 Identity = 101/130 (77.69%), Postives = 111/130 (85.38%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy Swiss-Prot
Match: Q93V47 (Guanine nucleotide-binding protein subunit gamma 2 OS=Arabidopsis thaliana OX=3702 GN=GG2 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.4e-16 Identity = 37/68 (54.41%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy Swiss-Prot
Match: A2X0N9 (Guanine nucleotide-binding protein subunit gamma 2 OS=Oryza sativa subsp. indica OX=39946 GN=RGG2 PE=2 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.1e-14 Identity = 39/109 (35.78%), Postives = 65/109 (59.63%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy Swiss-Prot
Match: Q6YXX9 (Guanine nucleotide-binding protein subunit gamma 2 OS=Oryza sativa subsp. japonica OX=39947 GN=RGG2 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.1e-14 Identity = 39/109 (35.78%), Postives = 65/109 (59.63%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy Swiss-Prot
Match: Q9FDX9 (Guanine nucleotide-binding protein subunit gamma 1 OS=Arabidopsis thaliana OX=3702 GN=GG1 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 6.0e-14 Identity = 34/76 (44.74%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy Swiss-Prot
Match: B8AN27 (Guanine nucleotide-binding protein subunit gamma 1 OS=Oryza sativa subsp. indica OX=39946 GN=RGG1 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.3e-10 Identity = 30/78 (38.46%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy TrEMBL
Match: A0A1S3CR73 (guanine nucleotide-binding protein subunit gamma 2-like OS=Cucumis melo OX=3656 GN=LOC103503775 PE=4 SV=1) HSP 1 Score: 210.7 bits (535), Expect = 3.7e-51 Identity = 110/133 (82.71%), Postives = 117/133 (87.97%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy TrEMBL
Match: A0A0A0LJE8 (G protein gamma domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G881640 PE=4 SV=1) HSP 1 Score: 209.1 bits (531), Expect = 1.1e-50 Identity = 109/133 (81.95%), Postives = 114/133 (85.71%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy TrEMBL
Match: A0A6J1FFX4 (guanine nucleotide-binding protein subunit gamma 2-like OS=Cucurbita moschata OX=3662 GN=LOC111443682 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 6.8e-45 Identity = 101/130 (77.69%), Postives = 111/130 (85.38%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy TrEMBL
Match: A0A6J1IGB7 (guanine nucleotide-binding protein subunit gamma 2-like OS=Cucurbita maxima OX=3661 GN=LOC111476672 PE=4 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 4.9e-43 Identity = 99/130 (76.15%), Postives = 109/130 (83.85%), Query Frame = 0
BLAST of CaUC05G096790 vs. ExPASy TrEMBL
Match: A0A6J1DUG2 (guanine nucleotide-binding protein subunit gamma 2-like OS=Momordica charantia OX=3673 GN=LOC111023181 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 3.5e-41 Identity = 94/132 (71.21%), Postives = 106/132 (80.30%), Query Frame = 0
BLAST of CaUC05G096790 vs. TAIR 10
Match: AT3G22942.1 (G-protein gamma subunit 2 ) HSP 1 Score: 84.7 bits (208), Expect = 6.0e-17 Identity = 37/68 (54.41%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of CaUC05G096790 vs. TAIR 10
Match: AT3G63420.1 (Ggamma-subunit 1 ) HSP 1 Score: 78.6 bits (192), Expect = 4.3e-15 Identity = 34/76 (44.74%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of CaUC05G096790 vs. TAIR 10
Match: AT3G63420.2 (Ggamma-subunit 1 ) HSP 1 Score: 78.6 bits (192), Expect = 4.3e-15 Identity = 34/76 (44.74%), Postives = 51/76 (67.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|