
CaUC01G007190 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGCCGCCGCTTCCAACCGCCCTGTCCGACTTCTCCTCTGCCTTGTTATTGCGTTAAGCGGCGTCCTTTTTACTGATGCGGAGCTTCGGCGATTTCCCCATCCCTCCAAAGACGACGGCTCTCTCAGCCTTCTGGTCGTCGGAGACTGGGGACGAAACGGAGAATACAACCAATCTCAAGTTGCCCTTCAGGTCCTCTCTCTCTCTCCTACAACCAATCTCTGTAATTTAGTCATTAAACTTTTATTAATAACAATTTCAATCTCTATACTTTCTATACTTCCAATTACCGTTATTGTTACTAATAAGTTTACATAA ATGGACGCCGCCGCTTCCAACCGCCCTGTCCGACTTCTCCTCTGCCTTGTTATTGCGTTAAGCGGCGTCCTTTTTACTGATGCGGAGCTTCGGCGATTTCCCCATCCCTCCAAAGACGACGGCTCTCTCAGCCTTCTGGTCGTCGGAGACTGGGGACGAAACGGAGAATACAACCAATCTCAAGTTGCCCTTCAGGTCCTCTCTCTCTCTCCTACAACCAATCTCTGTAATTTAGTCATTAAACTTTTATTAATAACAATTTCAATCTCTATACTTTCTATACTTCCAATTACCGTTATTGTTACTAATAAGTTTACATAA ATGGACGCCGCCGCTTCCAACCGCCCTGTCCGACTTCTCCTCTGCCTTGTTATTGCGTTAAGCGGCGTCCTTTTTACTGATGCGGAGCTTCGGCGATTTCCCCATCCCTCCAAAGACGACGGCTCTCTCAGCCTTCTGGTCGTCGGAGACTGGGGACGAAACGGAGAATACAACCAATCTCAAGTTGCCCTTCAGGTCCTCTCTCTCTCTCCTACAACCAATCTCTGTAATTTAGTCATTAAACTTTTATTAATAACAATTTCAATCTCTATACTTTCTATACTTCCAATTACCGTTATTGTTACTAATAAGTTTACATAA MDAAASNRPVRLLLCLVIALSGVLFTDAELRRFPHPSKDDGSLSLLVVGDWGRNGEYNQSQVALQVLSLSPTTNLCNLVIKLLLITISISILSILPITVIVTNKFT Homology
BLAST of CaUC01G007190 vs. NCBI nr
Match: XP_016903715.1 (PREDICTED: purple acid phosphatase 4-like [Cucumis melo]) HSP 1 Score: 108.6 bits (270), Expect = 3.3e-20 Identity = 59/77 (76.62%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CaUC01G007190 vs. NCBI nr
Match: XP_022939885.1 (purple acid phosphatase 3-like [Cucurbita moschata]) HSP 1 Score: 103.2 bits (256), Expect = 1.4e-18 Identity = 51/66 (77.27%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of CaUC01G007190 vs. NCBI nr
Match: XP_023550610.1 (purple acid phosphatase 17-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 103.2 bits (256), Expect = 1.4e-18 Identity = 51/66 (77.27%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of CaUC01G007190 vs. NCBI nr
Match: XP_022994036.1 (purple acid phosphatase 3-like [Cucurbita maxima]) HSP 1 Score: 102.8 bits (255), Expect = 1.8e-18 Identity = 52/66 (78.79%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of CaUC01G007190 vs. NCBI nr
Match: KAG6579177.1 (Purple acid phosphatase 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 102.4 bits (254), Expect = 2.4e-18 Identity = 50/66 (75.76%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy Swiss-Prot
Match: Q8VYZ2 (Purple acid phosphatase 8 OS=Arabidopsis thaliana OX=3702 GN=PAP8 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.6e-12 Identity = 42/82 (51.22%), Postives = 52/82 (63.41%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy Swiss-Prot
Match: Q8H129 (Purple acid phosphatase 3 OS=Arabidopsis thaliana OX=3702 GN=PAP3 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.2e-10 Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy Swiss-Prot
Match: Q9SCX8 (Purple acid phosphatase 17 OS=Arabidopsis thaliana OX=3702 GN=PAP17 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.7e-09 Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy Swiss-Prot
Match: Q8VYU7 (Purple acid phosphatase 4 OS=Arabidopsis thaliana OX=3702 GN=PAP4 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.0e-08 Identity = 30/55 (54.55%), Postives = 38/55 (69.09%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy Swiss-Prot
Match: Q8S341 (Purple acid phosphatase 7 OS=Arabidopsis thaliana OX=3702 GN=PAP7 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 6.3e-06 Identity = 28/59 (47.46%), Postives = 37/59 (62.71%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy TrEMBL
Match: A0A1S4E6U0 (Acid phosphatase OS=Cucumis melo OX=3656 GN=LOC103483030 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.6e-20 Identity = 59/77 (76.62%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy TrEMBL
Match: A0A6J1FP06 (Purple acid phosphatase OS=Cucurbita moschata OX=3662 GN=LOC111445616 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 6.8e-19 Identity = 51/66 (77.27%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy TrEMBL
Match: A0A6J1JY06 (Purple acid phosphatase OS=Cucurbita maxima OX=3661 GN=LOC111489845 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 8.8e-19 Identity = 52/66 (78.79%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy TrEMBL
Match: A0A5A7TSB4 (Purple acid phosphatase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold857G00100 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 4.4e-18 Identity = 51/65 (78.46%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of CaUC01G007190 vs. ExPASy TrEMBL
Match: A0A0A0KP97 (Purple acid phosphatase OS=Cucumis sativus OX=3659 GN=Csa_5G548110 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 1.3e-17 Identity = 49/65 (75.38%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of CaUC01G007190 vs. TAIR 10
Match: AT2G01890.1 (purple acid phosphatase 8 ) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-13 Identity = 42/82 (51.22%), Postives = 52/82 (63.41%), Query Frame = 0
BLAST of CaUC01G007190 vs. TAIR 10
Match: AT2G01890.2 (purple acid phosphatase 8 ) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-13 Identity = 42/82 (51.22%), Postives = 52/82 (63.41%), Query Frame = 0
BLAST of CaUC01G007190 vs. TAIR 10
Match: AT1G14700.1 (purple acid phosphatase 3 ) HSP 1 Score: 65.5 bits (158), Expect = 3.0e-11 Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 0
BLAST of CaUC01G007190 vs. TAIR 10
Match: AT1G14700.2 (purple acid phosphatase 3 ) HSP 1 Score: 65.5 bits (158), Expect = 3.0e-11 Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 0
BLAST of CaUC01G007190 vs. TAIR 10
Match: AT3G17790.1 (purple acid phosphatase 17 ) HSP 1 Score: 62.0 bits (149), Expect = 3.3e-10 Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|