
CSPI02G06300 (gene) Cucumber (PI 183967) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTCACTATTGCACACAGATTAAATACCATCATAGACTGTGATCGAATTCTTCTACTTGAATTTGGTCAGGTAAAGTTTTTCTTACTTTCAATAATATCATTCAATCAATGCACTTAATTACCCATATTAACATTCTAGTTCTATTTGAGTTGCAGTATATCTTTTTCTATCTTTCTACTACAAGCATTAGTCTCTTATTGTTTGCTTTTTTACATAATAGGTGTTGGAGTACGACACTCCAAAACAACTTTTATCGAATGAAGAAAGTGATTTTTCAAAGATGGTTCAAAGTACAGGAGTTGCCAATGCTCAATACTTGCACAAATTAGTATTTGAAGGTCAAGACAACATAGGAATAAGCAAGGAAATGTGA ATGCTCACTATTGCACACAGATTAAATACCATCATAGACTGTGATCGAATTCTTCTACTTGAATTTGGTCAGGTGTTGGAGTACGACACTCCAAAACAACTTTTATCGAATGAAGAAAGTGATTTTTCAAAGATGGTTCAAAGTACAGGAGTTGCCAATGCTCAATACTTGCACAAATTAGTATTTGAAGGTCAAGACAACATAGGAATAAGCAAGGAAATGTGA ATGCTCACTATTGCACACAGATTAAATACCATCATAGACTGTGATCGAATTCTTCTACTTGAATTTGGTCAGGTGTTGGAGTACGACACTCCAAAACAACTTTTATCGAATGAAGAAAGTGATTTTTCAAAGATGGTTCAAAGTACAGGAGTTGCCAATGCTCAATACTTGCACAAATTAGTATTTGAAGGTCAAGACAACATAGGAATAAGCAAGGAAATGTGA MLTIAHRLNTIIDCDRILLLEFGQVLEYDTPKQLLSNEESDFSKMVQSTGVANAQYLHKLVFEGQDNIGISKEM* Homology
BLAST of CSPI02G06300 vs. ExPASy Swiss-Prot
Match: Q9C8H0 (ABC transporter C family member 12 OS=Arabidopsis thaliana OX=3702 GN=ABCC12 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.0e-19 Identity = 46/67 (68.66%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy Swiss-Prot
Match: Q9C8H1 (ABC transporter C family member 11 OS=Arabidopsis thaliana OX=3702 GN=ABCC11 PE=2 SV=2) HSP 1 Score: 90.5 bits (223), Expect = 8.7e-18 Identity = 45/67 (67.16%), Postives = 52/67 (77.61%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy Swiss-Prot
Match: Q42093 (ABC transporter C family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCC2 PE=1 SV=2) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-17 Identity = 43/65 (66.15%), Postives = 53/65 (81.54%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy Swiss-Prot
Match: Q9C8G9 (ABC transporter C family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCC1 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.3e-17 Identity = 41/65 (63.08%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy Swiss-Prot
Match: Q54LE6 (ABC transporter C family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcC5 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.8e-10 Identity = 29/61 (47.54%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy TrEMBL
Match: A0A0A0LGU8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G060460 PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.9e-33 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy TrEMBL
Match: A0A5A7TBT5 (ABC transporter C family member 2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold47G00050 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.1e-28 Identity = 67/74 (90.54%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy TrEMBL
Match: A0A6J1CYS4 (ABC transporter C family member 2-like OS=Momordica charantia OX=3673 GN=LOC111015826 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 2.5e-20 Identity = 55/75 (73.33%), Postives = 63/75 (84.00%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy TrEMBL
Match: A0A6P6AD05 (ABC transporter C family member 2-like OS=Durio zibethinus OX=66656 GN=LOC111308549 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 5.6e-20 Identity = 54/71 (76.06%), Postives = 60/71 (84.51%), Query Frame = 0
BLAST of CSPI02G06300 vs. ExPASy TrEMBL
Match: B9HZ05 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_011G043100 PE=4 SV=3) HSP 1 Score: 105.9 bits (263), Expect = 7.4e-20 Identity = 52/67 (77.61%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of CSPI02G06300 vs. NCBI nr
Match: KAE8651675.1 (hypothetical protein Csa_021219, partial [Cucumis sativus]) HSP 1 Score: 148.7 bits (374), Expect = 2.0e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of CSPI02G06300 vs. NCBI nr
Match: KAA0038845.1 (ABC transporter C family member 2 [Cucumis melo var. makuwa]) HSP 1 Score: 135.2 bits (339), Expect = 2.3e-28 Identity = 67/74 (90.54%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of CSPI02G06300 vs. NCBI nr
Match: XP_038877675.1 (ABC transporter C family member 2-like isoform X3 [Benincasa hispida] >XP_038877676.1 ABC transporter C family member 2-like isoform X3 [Benincasa hispida] >XP_038877677.1 ABC transporter C family member 2-like isoform X3 [Benincasa hispida]) HSP 1 Score: 107.8 bits (268), Expect = 4.0e-20 Identity = 53/65 (81.54%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CSPI02G06300 vs. NCBI nr
Match: XP_038877673.1 (ABC transporter C family member 2-like isoform X1 [Benincasa hispida]) HSP 1 Score: 107.8 bits (268), Expect = 4.0e-20 Identity = 53/65 (81.54%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CSPI02G06300 vs. NCBI nr
Match: XP_038877674.1 (ABC transporter C family member 2-like isoform X2 [Benincasa hispida]) HSP 1 Score: 107.8 bits (268), Expect = 4.0e-20 Identity = 53/65 (81.54%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CSPI02G06300 vs. TAIR 10
Match: AT1G30410.1 (multidrug resistance-associated protein 13 ) HSP 1 Score: 94.4 bits (233), Expect = 4.3e-20 Identity = 46/67 (68.66%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of CSPI02G06300 vs. TAIR 10
Match: AT1G30420.1 (multidrug resistance-associated protein 12 ) HSP 1 Score: 90.5 bits (223), Expect = 6.2e-19 Identity = 45/67 (67.16%), Postives = 52/67 (77.61%), Query Frame = 0
BLAST of CSPI02G06300 vs. TAIR 10
Match: AT2G34660.1 (multidrug resistance-associated protein 2 ) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-18 Identity = 43/65 (66.15%), Postives = 53/65 (81.54%), Query Frame = 0
BLAST of CSPI02G06300 vs. TAIR 10
Match: AT2G34660.2 (multidrug resistance-associated protein 2 ) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-18 Identity = 43/65 (66.15%), Postives = 53/65 (81.54%), Query Frame = 0
BLAST of CSPI02G06300 vs. TAIR 10
Match: AT1G30400.1 (multidrug resistance-associated protein 1 ) HSP 1 Score: 88.2 bits (217), Expect = 3.1e-18 Identity = 41/65 (63.08%), Postives = 52/65 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (PI 183967) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|