
Bhi12G000935 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTCAGATTCATTGCAACAGGCTTTGAAGTTGTTGGTCGACTTTAGGTTTAACCCTACAGACCAAATACTCATGGAGCATTATCTTTACAATAAGATTCATACCCTTCCCTATTCTACACTCGTTGTTTTTTACTGTGATCTCTACGAAGATTTGGAGCCTTGGGAAATTTGGAATTCCTATGGTGGTGTTGATGGCTAA ATGGATTCAGATTCATTGCAACAGGCTTTGAAGTTGTTGGTCGACTTTAGGTTTAACCCTACAGACCAAATACTCATGGAGCATTATCTTTACAATAAGATTCATACCCTTCCCTATTCTACACTCGTTGTTTTTTACTGTGATCTCTACGAAGATTTGGAGCCTTGGGAAATTTGGAATTCCTATGGTGGTGTTGATGGCTAA ATGGATTCAGATTCATTGCAACAGGCTTTGAAGTTGTTGGTCGACTTTAGGTTTAACCCTACAGACCAAATACTCATGGAGCATTATCTTTACAATAAGATTCATACCCTTCCCTATTCTACACTCGTTGTTTTTTACTGTGATCTCTACGAAGATTTGGAGCCTTGGGAAATTTGGAATTCCTATGGTGGTGTTGATGGCTAA MDSDSLQQALKLLVDFRFNPTDQILMEHYLYNKIHTLPYSTLVVFYCDLYEDLEPWEIWNSYGGVDG Homology
BLAST of Bhi12G000935 vs. TAIR 10
Match: AT1G61110.1 (NAC domain containing protein 25 ) HSP 1 Score: 41.2 bits (95), Expect = 3.8e-04 Identity = 18/43 (41.86%), Postives = 28/43 (65.12%), Query Frame = 0
BLAST of Bhi12G000935 vs. TAIR 10
Match: AT1G52880.1 (NAC (No Apical Meristem) domain transcriptional regulator superfamily protein ) HSP 1 Score: 40.8 bits (94), Expect = 5.0e-04 Identity = 18/43 (41.86%), Postives = 28/43 (65.12%), Query Frame = 0
BLAST of Bhi12G000935 vs. TAIR 10
Match: AT3G15510.1 (NAC domain containing protein 2 ) HSP 1 Score: 40.4 bits (93), Expect = 6.5e-04 Identity = 18/43 (41.86%), Postives = 27/43 (62.79%), Query Frame = 0
BLAST of Bhi12G000935 vs. TAIR 10
Match: AT5G07680.1 (NAC domain containing protein 80 ) HSP 1 Score: 40.4 bits (93), Expect = 6.5e-04 Identity = 19/43 (44.19%), Postives = 27/43 (62.79%), Query Frame = 0
BLAST of Bhi12G000935 vs. TAIR 10
Match: AT5G07680.2 (NAC domain containing protein 80 ) HSP 1 Score: 40.4 bits (93), Expect = 6.5e-04 Identity = 19/43 (44.19%), Postives = 27/43 (62.79%), Query Frame = 0
BLAST of Bhi12G000935 vs. NCBI nr
Match: XP_038877574.1 (NAC domain-containing protein 96-like [Benincasa hispida]) HSP 1 Score: 131.7 bits (330), Expect = 2.3e-27 Identity = 61/67 (91.04%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of Bhi12G000935 vs. NCBI nr
Match: KAG6571608.1 (NAC domain-containing protein 30, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 67.4 bits (163), Expect = 5.4e-08 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Bhi12G000935 vs. NCBI nr
Match: KAE8651260.1 (hypothetical protein Csa_001645, partial [Cucumis sativus]) HSP 1 Score: 65.5 bits (158), Expect = 2.0e-07 Identity = 34/65 (52.31%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of Bhi12G000935 vs. NCBI nr
Match: XP_011652873.2 (NAC transcription factor 56 [Cucumis sativus]) HSP 1 Score: 65.5 bits (158), Expect = 2.0e-07 Identity = 34/65 (52.31%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of Bhi12G000935 vs. NCBI nr
Match: XP_022963780.1 (NAC transcription factor 25-like [Cucurbita moschata]) HSP 1 Score: 65.1 bits (157), Expect = 2.7e-07 Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 0
BLAST of Bhi12G000935 vs. ExPASy TrEMBL
Match: A0A0A0LFJ5 (NAC domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G838730 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 9.9e-08 Identity = 34/65 (52.31%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of Bhi12G000935 vs. ExPASy TrEMBL
Match: A0A6J1HIZ2 (NAC transcription factor 25-like OS=Cucurbita moschata OX=3662 GN=LOC111463972 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 1.3e-07 Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 0
BLAST of Bhi12G000935 vs. ExPASy TrEMBL
Match: A0A0A0KXM1 (NAC domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G296900 PE=4 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 36/69 (52.17%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of Bhi12G000935 vs. ExPASy TrEMBL
Match: A0A0A0M0I5 (NAC domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G652300 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 3.8e-07 Identity = 30/54 (55.56%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of Bhi12G000935 vs. ExPASy TrEMBL
Match: A0A6J1HSR6 (NAC domain-containing protein 72-like OS=Cucurbita maxima OX=3661 GN=LOC111467095 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 4.9e-07 Identity = 30/56 (53.57%), Postives = 37/56 (66.07%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|