![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Bhi12G000734 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTCAGGAGAAATTGGTACAAGAAGCCGTGGATGCACTTCTTGATAATGGAATCCGCGGACAACCAATGAGGGATGGCCATAATAAGGTTTACAAGTCGTTTTCCGATGTAATTGAAGGCAAAGAGGGAAGATTTCAAAGTAATGAGCCTCATTGTGAGGCTCATTACTTCAATTGA ATGTGTCAGGAGAAATTGGTACAAGAAGCCGTGGATGCACTTCTTGATAATGGAATCCGCGGACAACCAATGAGGGATGGCCATAATAAGGTTTACAAGTCGTTTTCCGATGTAATTGAAGGCAAAGAGGGAAGATTTCAAAGTAATGAGCCTCATTGTGAGGCTCATTACTTCAATTGA ATGTGTCAGGAGAAATTGGTACAAGAAGCCGTGGATGCACTTCTTGATAATGGAATCCGCGGACAACCAATGAGGGATGGCCATAATAAGGTTTACAAGTCGTTTTCCGATGTAATTGAAGGCAAAGAGGGAAGATTTCAAAGTAATGAGCCTCATTGTGAGGCTCATTACTTCAATTGA MCQEKLVQEAVDALLDNGIRGQPMRDGHNKVYKSFSDVIEGKEGRFQSNEPHCEAHYFN Homology
BLAST of Bhi12G000734 vs. TAIR 10
Match: ATCG00180.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 97.1 bits (240), Expect = 5.2e-21 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy Swiss-Prot
Match: A9LYH6 (DNA-directed RNA polymerase subunit beta' OS=Acorus americanus OX=263995 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 7.3e-20 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy Swiss-Prot
Match: Q3V543 (DNA-directed RNA polymerase subunit beta' OS=Acorus calamus OX=4465 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 7.3e-20 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy Swiss-Prot
Match: Q5QA71 (DNA-directed RNA polymerase subunit beta' OS=Acorus gramineus OX=55184 GN=rpoC1 PE=3 SV=2) HSP 1 Score: 97.1 bits (240), Expect = 7.3e-20 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy Swiss-Prot
Match: A4QJA6 (DNA-directed RNA polymerase subunit beta' OS=Aethionema cordifolium OX=434059 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 7.3e-20 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy Swiss-Prot
Match: P60287 (DNA-directed RNA polymerase subunit beta' OS=Amborella trichopoda OX=13333 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 7.3e-20 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Bhi12G000734 vs. NCBI nr
Match: YP_009493578.1 (RNA polymerase beta' subunit [Eucommia ulmoides] >ANP25493.1 RNA polymerase beta' subunit [Eucommia ulmoides] >AWN56500.1 RNA polymerase beta' subunit [Eucommia ulmoides] >AZT79263.1 RNA polymerase beta' subunit [Eucommia ulmoides]) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. NCBI nr
Match: AHI87518.1 (RNA polymerase beta subunit [Chionographis japonica]) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. NCBI nr
Match: QTX95148.1 (RNA polymerase beta' subunit [Allium macranthum]) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. NCBI nr
Match: YP_009671372.1 (RNA polymerase beta' subunit [Passiflora obovata] >QCX30650.1 RNA polymerase beta' subunit [Passiflora obovata]) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. NCBI nr
Match: ALI91141.1 (RpoC1, partial [Phytocrene racemosa]) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy TrEMBL
Match: A0A1B0ZD05 (DNA-directed RNA polymerase subunit beta' OS=Eucommia ulmoides OX=4392 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.3e-18 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy TrEMBL
Match: A0A6M8TUZ6 (DNA-directed RNA polymerase subunit beta' OS=Allium macranthum OX=165633 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.3e-18 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy TrEMBL
Match: A0A0S0ZL22 (DNA-directed RNA polymerase subunit (Fragment) OS=Phytocrene racemosa OX=1705849 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.3e-18 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy TrEMBL
Match: W6CL66 (DNA-directed RNA polymerase subunit beta' OS=Chionographis japonica OX=119999 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.3e-18 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Bhi12G000734 vs. ExPASy TrEMBL
Match: A0A4Y5QG88 (DNA-directed RNA polymerase subunit beta' OS=Passiflora obovata OX=378248 GN=rpoC1 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.3e-18 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|