Bhi07G000011 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGCTTTGGTTACATTCGGAGAAGGGTGGCGCAATATCCACCATGCATTCGAGTATTCGGCAAGACATGGTCATGAATGGTGGCAGATTGACTTCGGTTGGTACTTCATCATGTTTCTTCAAGCAATAGGATTGGCGACTGATGTTAAATTACCCCCAGCTTCAAAAGTAGCAGTAAAACTTTCATAA ATGGTAGCTTTGGTTACATTCGGAGAAGGGTGGCGCAATATCCACCATGCATTCGAGTATTCGGCAAGACATGGTCATGAATGGTGGCAGATTGACTTCGGTTGGTACTTCATCATGTTTCTTCAAGCAATAGGATTGGCGACTGATGTTAAATTACCCCCAGCTTCAAAAGTAGCAGTAAAACTTTCATAA ATGGTAGCTTTGGTTACATTCGGAGAAGGGTGGCGCAATATCCACCATGCATTCGAGTATTCGGCAAGACATGGTCATGAATGGTGGCAGATTGACTTCGGTTGGTACTTCATCATGTTTCTTCAAGCAATAGGATTGGCGACTGATGTTAAATTACCCCCAGCTTCAAAAGTAGCAGTAAAACTTTCATAA MVALVTFGEGWRNIHHAFEYSARHGHEWWQIDFGWYFIMFLQAIGLATDVKLPPASKVAVKLS Homology
BLAST of Bhi07G000011 vs. TAIR 10
Match: AT3G15850.1 (fatty acid desaturase 5 ) HSP 1 Score: 92.0 bits (227), Expect = 1.8e-19 Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR 10
Match: AT3G15870.1 (Fatty acid desaturase family protein ) HSP 1 Score: 87.4 bits (215), Expect = 4.4e-18 Identity = 38/60 (63.33%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR 10
Match: AT1G06080.1 (delta 9 desaturase 1 ) HSP 1 Score: 83.2 bits (204), Expect = 8.3e-17 Identity = 35/56 (62.50%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR 10
Match: AT1G06100.1 (Fatty acid desaturase family protein ) HSP 1 Score: 81.3 bits (199), Expect = 3.1e-16 Identity = 35/52 (67.31%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi07G000011 vs. TAIR 10
Match: AT1G06090.1 (Fatty acid desaturase family protein ) HSP 1 Score: 79.3 bits (194), Expect = 1.2e-15 Identity = 34/48 (70.83%), Postives = 37/48 (77.08%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy Swiss-Prot
Match: Q949X0 (Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADS3 PE=1 SV=2) HSP 1 Score: 92.0 bits (227), Expect = 2.5e-18 Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy Swiss-Prot
Match: Q9LVZ3 (Probable lipid desaturase ADS3.2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADS3.2 PE=2 SV=3) HSP 1 Score: 87.4 bits (215), Expect = 6.2e-17 Identity = 38/60 (63.33%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy Swiss-Prot
Match: Q9FV68 (Icosanoyl-CoA 5-desaturase (Fragment) OS=Limnanthes douglasii OX=28973 PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-16 Identity = 39/52 (75.00%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy Swiss-Prot
Match: P0DOW2 (Acyl-CoA C20 Delta5-desaturase OS=Anemone leveillei OX=212809 GN=AL10 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-16 Identity = 35/52 (67.31%), Postives = 42/52 (80.77%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy Swiss-Prot
Match: P0DOW3 (Acyl-CoA 5-desaturase AL21 OS=Anemone leveillei OX=212809 GN=AL21 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-16 Identity = 36/52 (69.23%), Postives = 42/52 (80.77%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy TrEMBL
Match: A0A6J1DQF3 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Momordica charantia OX=3673 GN=LOC111022855 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.1e-21 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy TrEMBL
Match: A0A6J1JX80 (delta-9 acyl-lipid desaturase 2-like OS=Cucurbita maxima OX=3661 GN=LOC111488301 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 3.6e-20 Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy TrEMBL
Match: A0A6J1GMY0 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111455910 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 4.7e-20 Identity = 46/53 (86.79%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy TrEMBL
Match: A0A0A0KAB1 (FA_desaturase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G376370 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 6.2e-20 Identity = 45/53 (84.91%), Postives = 48/53 (90.57%), Query Frame = 0
BLAST of Bhi07G000011 vs. ExPASy TrEMBL
Match: A0A6J1JUL6 (palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like OS=Cucurbita maxima OX=3661 GN=LOC111488510 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.1e-19 Identity = 45/53 (84.91%), Postives = 47/53 (88.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|