Bhi04G000705 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATCTACGAGGTGAAGCAGCAGAAACTTTATATTTTGAGGCAAAATGTAGAATTGAAGATCCAATTTATGGATGTGTTGGAATTATTTATCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCGAAAACTCAAGCTGAGATTGCTTTGTTGACTTCCAATGTTCAAGAAGCCCAACCCAATGATTTTGCATTTGAGCCCATCATAGGCCCAAATAATATTGGGCTTTCCATTCCATCCCATTGGTTTCATTTCTAA ATGCATCTACGAGGTGAAGCAGCAGAAACTTTATATTTTGAGGCAAAATGTAGAATTGAAGATCCAATTTATGGATGTGTTGGAATTATTTATCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCGAAAACTCAAGCTGAGATTGCTTTGTTGACTTCCAATGTTCAAGAAGCCCAACCCAATGATTTTGCATTTGAGCCCATCATAGGCCCAAATAATATTGGGCTTTCCATTCCATCCCATTGGTTTCATTTCTAA ATGCATCTACGAGGTGAAGCAGCAGAAACTTTATATTTTGAGGCAAAATGTAGAATTGAAGATCCAATTTATGGATGTGTTGGAATTATTTATCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCGAAAACTCAAGCTGAGATTGCTTTGTTGACTTCCAATGTTCAAGAAGCCCAACCCAATGATTTTGCATTTGAGCCCATCATAGGCCCAAATAATATTGGGCTTTCCATTCCATCCCATTGGTTTCATTTCTAA MHLRGEAAETLYFEAKCRIEDPIYGCVGIIYQLQYELHVAETQLAKTQAEIALLTSNVQEAQPNDFAFEPIIGPNNIGLSIPSHWFHF Homology
BLAST of Bhi04G000705 vs. TAIR 10
Match: AT3G26660.1 (LOB domain-containing protein 24 ) HSP 1 Score: 76.3 bits (186), Expect = 1.4e-14 Identity = 33/63 (52.38%), Postives = 48/63 (76.19%), Query Frame = 0
BLAST of Bhi04G000705 vs. TAIR 10
Match: AT3G26620.1 (LOB domain-containing protein 23 ) HSP 1 Score: 73.9 bits (180), Expect = 7.0e-14 Identity = 32/63 (50.79%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of Bhi04G000705 vs. TAIR 10
Match: AT1G31320.1 (LOB domain-containing protein 4 ) HSP 1 Score: 59.3 bits (142), Expect = 1.8e-09 Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi04G000705 vs. TAIR 10
Match: AT1G16530.1 (ASYMMETRIC LEAVES 2-like 9 ) HSP 1 Score: 55.5 bits (132), Expect = 2.6e-08 Identity = 28/74 (37.84%), Postives = 43/74 (58.11%), Query Frame = 0
BLAST of Bhi04G000705 vs. TAIR 10
Match: AT2G30130.1 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 55.1 bits (131), Expect = 3.4e-08 Identity = 25/51 (49.02%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy Swiss-Prot
Match: P59468 (LOB domain-containing protein 24 OS=Arabidopsis thaliana OX=3702 GN=LBD24 PE=2 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.0e-13 Identity = 33/63 (52.38%), Postives = 48/63 (76.19%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy Swiss-Prot
Match: P59467 (LOB domain-containing protein 23 OS=Arabidopsis thaliana OX=3702 GN=LBD23 PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.9e-13 Identity = 32/63 (50.79%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy Swiss-Prot
Match: Q9SHE9 (LOB domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=LBD4 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.5e-08 Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy Swiss-Prot
Match: Q9SA51 (LOB domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=LBD3 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.6e-07 Identity = 28/74 (37.84%), Postives = 43/74 (58.11%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy Swiss-Prot
Match: Q8LBW3 (LOB domain-containing protein 12 OS=Arabidopsis thaliana OX=3702 GN=LBD12 PE=1 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 4.7e-07 Identity = 25/51 (49.02%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy TrEMBL
Match: A0A6J1E5I6 (LOB domain-containing protein 24-like OS=Cucurbita moschata OX=3662 GN=LOC111430896 PE=3 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 4.1e-30 Identity = 67/92 (72.83%), Postives = 79/92 (85.87%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy TrEMBL
Match: A0A6J1JCD0 (LOB domain-containing protein 24-like OS=Cucurbita maxima OX=3661 GN=LOC111483182 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 1.2e-29 Identity = 69/93 (74.19%), Postives = 78/93 (83.87%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy TrEMBL
Match: A0A0A0L9N7 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G180300 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 5.1e-28 Identity = 69/92 (75.00%), Postives = 76/92 (82.61%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy TrEMBL
Match: A0A1S3AY36 (LOB domain-containing protein 24-like OS=Cucumis melo OX=3656 GN=LOC103484045 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 8.6e-28 Identity = 68/93 (73.12%), Postives = 77/93 (82.80%), Query Frame = 0
BLAST of Bhi04G000705 vs. ExPASy TrEMBL
Match: A0A0A0LLX6 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G373510 PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 3.3e-27 Identity = 67/86 (77.91%), Postives = 72/86 (83.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|