Bhi03G000960 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCTTGTCTCTATCTTTGGCAATGTTGTTGATACTGACTATGGTGAGTTGTTTTCTAATGAAAGTGGTATTACTCTTGTCGATCGCTTTGATGCTTCAAAGTTTCCTATTCGGTTCAGTGGGCAGAAGACTCTTAAGGATGCTGACCTCGGTGGAGATAAGCGCTCTAAGGTCATTTGA ATGGGGCTTGTCTCTATCTTTGGCAATGTTGTTGATACTGACTATGGTGAGTTGTTTTCTAATGAAAGTGGTATTACTCTTGTCGATCGCTTTGATGCTTCAAAGTTTCCTATTCGGTTCAGTGGGCAGAAGACTCTTAAGGATGCTGACCTCGGTGGAGATAAGCGCTCTAAGGTCATTTGA ATGGGGCTTGTCTCTATCTTTGGCAATGTTGTTGATACTGACTATGGTGAGTTGTTTTCTAATGAAAGTGGTATTACTCTTGTCGATCGCTTTGATGCTTCAAAGTTTCCTATTCGGTTCAGTGGGCAGAAGACTCTTAAGGATGCTGACCTCGGTGGAGATAAGCGCTCTAAGGTCATTTGA MGLVSIFGNVVDTDYGELFSNESGITLVDRFDASKFPIRFSGQKTLKDADLGGDKRSKVI Homology
BLAST of Bhi03G000960 vs. TAIR 10
Match: AT5G46290.1 (3-ketoacyl-acyl carrier protein synthase I ) HSP 1 Score: 67.4 bits (163), Expect = 4.5e-12 Identity = 39/89 (43.82%), Postives = 47/89 (52.81%), Query Frame = 0
BLAST of Bhi03G000960 vs. TAIR 10
Match: AT5G46290.2 (3-ketoacyl-acyl carrier protein synthase I ) HSP 1 Score: 67.4 bits (163), Expect = 4.5e-12 Identity = 39/89 (43.82%), Postives = 47/89 (52.81%), Query Frame = 0
BLAST of Bhi03G000960 vs. TAIR 10
Match: AT5G46290.3 (3-ketoacyl-acyl carrier protein synthase I ) HSP 1 Score: 67.4 bits (163), Expect = 4.5e-12 Identity = 39/89 (43.82%), Postives = 47/89 (52.81%), Query Frame = 0
BLAST of Bhi03G000960 vs. ExPASy Swiss-Prot
Match: P52410 (3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KAS1 PE=1 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 6.3e-11 Identity = 39/89 (43.82%), Postives = 47/89 (52.81%), Query Frame = 0
BLAST of Bhi03G000960 vs. ExPASy Swiss-Prot
Match: P23902 (3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare OX=4513 GN=KAS12 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 3.8e-08 Identity = 26/43 (60.47%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of Bhi03G000960 vs. NCBI nr
Match: KAA0053963.1 (3-oxoacyl-(acyl-carrier-protein) synthase I [Cucumis melo var. makuwa] >TYK20647.1 3-oxoacyl-(acyl-carrier-protein) synthase I [Cucumis melo var. makuwa]) HSP 1 Score: 83.6 bits (205), Expect = 6.5e-13 Identity = 47/90 (52.22%), Postives = 52/90 (57.78%), Query Frame = 0
BLAST of Bhi03G000960 vs. NCBI nr
Match: XP_004147414.1 (3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Cucumis sativus] >KGN65557.1 hypothetical protein Csa_019968 [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 3.2e-12 Identity = 45/89 (50.56%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of Bhi03G000960 vs. NCBI nr
Match: XP_008444105.1 (PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Cucumis melo]) HSP 1 Score: 81.3 bits (199), Expect = 3.2e-12 Identity = 45/89 (50.56%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of Bhi03G000960 vs. NCBI nr
Match: XP_038895052.1 (3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic isoform X1 [Benincasa hispida]) HSP 1 Score: 79.7 bits (195), Expect = 9.4e-12 Identity = 44/89 (49.44%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of Bhi03G000960 vs. NCBI nr
Match: XP_038895053.1 (3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic isoform X2 [Benincasa hispida]) HSP 1 Score: 79.7 bits (195), Expect = 9.4e-12 Identity = 44/89 (49.44%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of Bhi03G000960 vs. ExPASy TrEMBL
Match: A0A5D3DAP3 (Beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold480G00310 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 3.1e-13 Identity = 47/90 (52.22%), Postives = 52/90 (57.78%), Query Frame = 0
BLAST of Bhi03G000960 vs. ExPASy TrEMBL
Match: A0A0A0LXL6 (Beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Cucumis sativus OX=3659 GN=Csa_1G447400 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.6e-12 Identity = 45/89 (50.56%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of Bhi03G000960 vs. ExPASy TrEMBL
Match: A0A1S3BAD8 (Beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Cucumis melo OX=3656 GN=LOC103487541 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.6e-12 Identity = 45/89 (50.56%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of Bhi03G000960 vs. ExPASy TrEMBL
Match: A0A5N6M4X3 (Beta-ketoacyl-[acyl-carrier-protein] synthase I OS=Mikania micrantha OX=192012 GN=E3N88_36835 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.7e-11 Identity = 44/89 (49.44%), Postives = 50/89 (56.18%), Query Frame = 0
BLAST of Bhi03G000960 vs. ExPASy TrEMBL
Match: A0A5N6M5W5 (PKS_KS domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_36836 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.7e-11 Identity = 44/89 (49.44%), Postives = 50/89 (56.18%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|