
Cmc09g0249441 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGTCACTACAACTATTTTACATGGAAGCCTAAAAGAAGACTTATATATGGAACAACCTAAAGGTTTTGAAGCTAAAGGAAAAATAGACCTAGTTTGCAAACTAAAGAAATCCTTATATGGATTGAAGCAGTCACCAAGGTGTTGGTATAAAAGGTTTAACGATTTCATCAACAAAATAGGCTTTATGAGAAGTTTATATGATCCTTATGTCTACTATAAGAAGCTAACTGATGGAAGCCTAATCTATTTACTGTTATATGTTAATGATATGCTATTGGTTGGTAAAAATCTTACTAAGCTAAATAAGATAAAAAGAACAGTTGAAGAATGA ATGGATGTCACTACAACTATTTTACATGGAAGCCTAAAAGAAGACTTATATATGGAACAACCTAAAGGTTTTGAAGCTAAAGGAAAAATAGACCTAGTTTGCAAACTAAAGAAATCCTTATATGGATTGAAGCAGTCACCAAGGTGTTGGTATAAAAGGTTTAACGATTTCATCAACAAAATAGGCTTTATGAGAAGTTTATATGATCCTTATGTCTACTATAAGAAGCTAACTGATGGAAGCCTAATCTATTTACTGTTATATGTTAATGATATGCTATTGGTTGGTAAAAATCTTACTAAGCTAAATAAGATAAAAAGAACAGTTGAAGAATGA ATGGATGTCACTACAACTATTTTACATGGAAGCCTAAAAGAAGACTTATATATGGAACAACCTAAAGGTTTTGAAGCTAAAGGAAAAATAGACCTAGTTTGCAAACTAAAGAAATCCTTATATGGATTGAAGCAGTCACCAAGGTGTTGGTATAAAAGGTTTAACGATTTCATCAACAAAATAGGCTTTATGAGAAGTTTATATGATCCTTATGTCTACTATAAGAAGCTAACTGATGGAAGCCTAATCTATTTACTGTTATATGTTAATGATATGCTATTGGTTGGTAAAAATCTTACTAAGCTAAATAAGATAAAAAGAACAGTTGAAGAATGA MDVTTTILHGSLKEDLYMEQPKGFEAKGKIDLVCKLKKSLYGLKQSPRCWYKRFNDFINKIGFMRSLYDPYVYYKKLTDGSLIYLLLYVNDMLLVGKNLTKLNKIKRTVEE Homology
BLAST of Cmc09g0249441 vs. NCBI nr
Match: KAA0047818.1 (retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 196.4 bits (498), Expect = 1.3e-46 Identity = 95/110 (86.36%), Postives = 102/110 (92.73%), Query Frame = 0
BLAST of Cmc09g0249441 vs. NCBI nr
Match: TYK02789.1 (retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 193.7 bits (491), Expect = 8.2e-46 Identity = 94/106 (88.68%), Postives = 99/106 (93.40%), Query Frame = 0
BLAST of Cmc09g0249441 vs. NCBI nr
Match: KAA0046197.1 (retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa] >TYK14164.1 retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 190.7 bits (483), Expect = 7.0e-45 Identity = 92/110 (83.64%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of Cmc09g0249441 vs. NCBI nr
Match: XP_008448404.1 (PREDICTED: retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo] >TYK14616.1 retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 190.7 bits (483), Expect = 7.0e-45 Identity = 93/110 (84.55%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of Cmc09g0249441 vs. NCBI nr
Match: CAJ65856.1 (putative reverse transcriptase, partial [Cucumis melo]) HSP 1 Score: 151.4 bits (381), Expect = 4.7e-33 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.3e-27 Identity = 55/106 (51.89%), Postives = 79/106 (74.53%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.4e-18 Identity = 43/103 (41.75%), Postives = 69/103 (66.99%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-17 Identity = 40/102 (39.22%), Postives = 66/102 (64.71%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 88.2 bits (217), Expect = 6.4e-17 Identity = 46/114 (40.35%), Postives = 72/114 (63.16%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy Swiss-Prot
Match: P0C2J7 (Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY4B-H PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.1e-08 Identity = 35/114 (30.70%), Postives = 57/114 (50.00%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy TrEMBL
Match: A0A5A7TXZ9 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold133G00700 PE=4 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 6.1e-47 Identity = 95/110 (86.36%), Postives = 102/110 (92.73%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy TrEMBL
Match: A0A5D3BXB7 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold145G00480 PE=4 SV=1) HSP 1 Score: 193.7 bits (491), Expect = 4.0e-46 Identity = 94/106 (88.68%), Postives = 99/106 (93.40%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy TrEMBL
Match: A0A5D3CT04 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold688G00190 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 3.4e-45 Identity = 92/110 (83.64%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy TrEMBL
Match: A0A5D3CW25 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1275G00010 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 3.4e-45 Identity = 93/110 (84.55%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of Cmc09g0249441 vs. ExPASy TrEMBL
Match: A0A1S3BJM4 (retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo OX=3656 GN=LOC103490605 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 3.4e-45 Identity = 93/110 (84.55%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of Cmc09g0249441 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 73.9 bits (180), Expect = 8.8e-14 Identity = 37/110 (33.64%), Postives = 69/110 (62.73%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|