
Cmc09g0252911.1 (mRNA) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATGCTCCTAGACTAGCTCACTTTGATGTTGTTTATAGAATCCTAAGATACTTAAAAGGTACTCCACGAAAAGGCATATTGTTTAAAAAACATGACCACCAAAATGTCAAAGTGTACACTAATGCTGATTGGGCAAGTACCACAACTGATAGAAAATCCACTTCTGGTTATTGCTCCTTTGTTGGAGGAAATCTAGTTACTTGGCGAAATAAAAACAGAGTGGTTGCAAGAAGTATTATAGAAGCAAAATTTAGGACATTAGCACATGGTATTTGTGAGGGCATATGGATAAGAAGACTATTGGAAGAATTGAGATTCTCTCAAACAATGTCTATTCACATTTATTGTGATAAAAAGGCAACAATTTTCATTGCCCACAATACGGTCCTTCGTGATTGGACAAAACATATTGAAGTTGATGAGCACCTCATAAAAGAGAAGATTGTTCAAGGTATAATATGCATCCTAATCTTCCAACAACAGAACAAATCGCACTTGTGTTAA ATGCATGCTCCTAGACTAGCTCACTTTGATGTTGTTTATAGAATCCTAAGATACTTAAAAGGTACTCCACGAAAAGGCATATTGTTTAAAAAACATGACCACCAAAATGTCAAAGTGTACACTAATGCTGATTGGGCAAGTACCACAACTGATAGAAAATCCACTTCTGGTTATTGCTCCTTTGTTGGAGGAAATCTAGTTACTTGGCGAAATAAAAACAGAGTGGTTGCAAGAAGTATTATAGAAGCAAAATTTAGGACATTAGCACATGGTATTTGTGAGGGCATATGGATAAGAAGACTATTGGAAGAATTGAGATTCTCTCAAACAATGTCTATTCACATTTATTGTGATAAAAAGGCAACAATTTTCATTGCCCACAATACGGTCCTTCGTGATTGGACAAAACATATTGAAGTTGATGAGCACCTCATAAAAGAGAAGATTGTTCAAGGTATAATATGCATCCTAATCTTCCAACAACAGAACAAATCGCACTTGTGTTAA ATGCATGCTCCTAGACTAGCTCACTTTGATGTTGTTTATAGAATCCTAAGATACTTAAAAGGTACTCCACGAAAAGGCATATTGTTTAAAAAACATGACCACCAAAATGTCAAAGTGTACACTAATGCTGATTGGGCAAGTACCACAACTGATAGAAAATCCACTTCTGGTTATTGCTCCTTTGTTGGAGGAAATCTAGTTACTTGGCGAAATAAAAACAGAGTGGTTGCAAGAAGTATTATAGAAGCAAAATTTAGGACATTAGCACATGGTATTTGTGAGGGCATATGGATAAGAAGACTATTGGAAGAATTGAGATTCTCTCAAACAATGTCTATTCACATTTATTGTGATAAAAAGGCAACAATTTTCATTGCCCACAATACGGTCCTTCGTGATTGGACAAAACATATTGAAGTTGATGAGCACCTCATAAAAGAGAAGATTGTTCAAGGTATAATATGCATCCTAATCTTCCAACAACAGAACAAATCGCACTTGTGTTAA MHAPRLAHFDVVYRILRYLKGTPRKGILFKKHDHQNVKVYTNADWASTTTDRKSTSGYCSFVGGNLVTWRNKNRVVARSIIEAKFRTLAHGICEGIWIRRLLEELRFSQTMSIHIYCDKKATIFIAHNTVLRDWTKHIEVDEHLIKEKIVQGIICILIFQQQNKSHLC Homology
BLAST of Cmc09g0252911.1 vs. NCBI nr
Match: XP_039014820.1 (LOW QUALITY PROTEIN: uncharacterized protein LOC120144958 [Hibiscus syriacus]) HSP 1 Score: 221.1 bits (562), Expect = 7.3e-54 Identity = 102/157 (64.97%), Postives = 124/157 (78.98%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. NCBI nr
Match: RVX14578.1 (Retrovirus-related Pol polyprotein from transposon RE1 [Vitis vinifera]) HSP 1 Score: 217.6 bits (553), Expect = 8.0e-53 Identity = 100/157 (63.69%), Postives = 124/157 (78.98%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. NCBI nr
Match: RVW50129.1 (Retrovirus-related Pol polyprotein from transposon RE1 [Vitis vinifera]) HSP 1 Score: 217.6 bits (553), Expect = 8.0e-53 Identity = 100/157 (63.69%), Postives = 124/157 (78.98%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. NCBI nr
Match: RVW65750.1 (Retrovirus-related Pol polyprotein from transposon RE1 [Vitis vinifera]) HSP 1 Score: 214.9 bits (546), Expect = 5.2e-52 Identity = 98/157 (62.42%), Postives = 123/157 (78.34%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. NCBI nr
Match: CAN60456.1 (hypothetical protein VITISV_019554 [Vitis vinifera]) HSP 1 Score: 214.5 bits (545), Expect = 6.8e-52 Identity = 98/157 (62.42%), Postives = 123/157 (78.34%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.8e-23 Identity = 58/158 (36.71%), Postives = 86/158 (54.43%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.3e-23 Identity = 57/158 (36.08%), Postives = 89/158 (56.33%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 93.6 bits (231), Expect = 2.3e-18 Identity = 53/155 (34.19%), Postives = 82/155 (52.90%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy Swiss-Prot
Match: P92519 (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 4.3e-17 Identity = 41/98 (41.84%), Postives = 64/98 (65.31%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 2.2e-16 Identity = 52/147 (35.37%), Postives = 82/147 (55.78%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy TrEMBL
Match: A0A1S8ACK5 (Cysteine-rich RLK RECEPTOR-like protein kinase OS=Citrus limon OX=2708 PE=4 SV=1) HSP 1 Score: 220.7 bits (561), Expect = 4.6e-54 Identity = 100/157 (63.69%), Postives = 126/157 (80.25%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy TrEMBL
Match: A0A2N9EE05 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS847 PE=4 SV=1) HSP 1 Score: 219.5 bits (558), Expect = 1.0e-53 Identity = 101/157 (64.33%), Postives = 126/157 (80.25%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy TrEMBL
Match: A0A2N9G304 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS21755 PE=4 SV=1) HSP 1 Score: 219.5 bits (558), Expect = 1.0e-53 Identity = 101/157 (64.33%), Postives = 126/157 (80.25%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy TrEMBL
Match: A0A438K065 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Vitis vinifera OX=29760 GN=RE1_1804 PE=4 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 3.9e-53 Identity = 100/157 (63.69%), Postives = 124/157 (78.98%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. ExPASy TrEMBL
Match: A0A438EQX0 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Vitis vinifera OX=29760 GN=RE1_267 PE=4 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 3.9e-53 Identity = 100/157 (63.69%), Postives = 124/157 (78.98%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 117.1 bits (292), Expect = 1.4e-26 Identity = 56/149 (37.58%), Postives = 92/149 (61.74%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. TAIR 10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 89.4 bits (220), Expect = 3.1e-18 Identity = 41/98 (41.84%), Postives = 64/98 (65.31%), Query Frame = 0
BLAST of Cmc09g0252911.1 vs. TAIR 10
Match: ATMG00240.1 (Gag-Pol-related retrotransposon family protein ) HSP 1 Score: 53.5 bits (127), Expect = 1.9e-07 Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|