TrEMBL blast output of UN98080
BLASTX 7.6.2 Query= UN98080 /QuerySize=324 (323 letters) Database: Uniprot/TrEMBL; 23,994,583 sequences; 7,812,677,823 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9RRS2|B9RRS2_RICCO Putative uncharacterized protein OS=Ricin... 58 6e-007 >tr|B9RRS2|B9RRS2_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0797410 PE=4 SV=1 Length = 316 Score = 58 bits (138), Expect = 6e-007 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 197 EDSTTLPSIWTSINNWCTPTILFLFLNFMIATILFTSNL 81 E T++PSIW S+N+W TPT+LFLFLN MI TI TS+L Sbjct: 4 ESVTSIPSIWASMNSWFTPTVLFLFLNLMIGTIYVTSSL 42 Database: Uniprot/TrEMBL Posted date: Thu Sep 27 19:50:57 2012 Number of letters in database: 7,812,677,823 Number of sequences in database: 23,994,583 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 691,116,954,505 Number of Sequences: 23994583 Number of Extensions: 691116954505 Number of Successful Extensions: 272997463 Number of sequences better than 0.0: 0 |